SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_03701 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_03701
Domain Number 1 Region: 752-840,874-916,951-1066
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.84e-38
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 
Domain Number 2 Region: 121-236
Classification Level Classification E-value
Superfamily L domain-like 1.97e-17
Family Ngr ectodomain-like 0.034
Further Details:      
 
Weak hits

Sequence:  PGTT_03701
Domain Number - Region: 1055-1089,1121-1226
Classification Level Classification E-value
Superfamily PH domain-like 0.0417
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_03701
Sequence length 1230
Comment | PGTG_03701 | Puccinia graminis f. sp. tritici conserved hypothetical protein (1231 aa)
Sequence
MSATTRRPPASNNTESVFDPRENYLSKGHYAESSTESKHRFYHHQSHWDDFDDQSPSMHS
SSQIPSQAVALVEDGRGCIVDISNSKTPLEKLAVPDDTTHLLLAKTFAPFLVGALLSSKL
SSIAGNLVVLDISDAGLTSLPSAIAYCEALEELNVSGNVMANGELPIFLSNLIALKVLAA
DRCGLYQIAYPYNGLTQLRDLSVRYNHLRSLPSWLCLLPRLEILLVDGNEFEPPWQDLVE
PLLCTSIYGRPEPQQHPSIGSCDPTDSRYFASSYPSPVASSVGSTLRSHPELSQNTRTPP
DEHRRNASAERPQRGRRHLAGSESTWVTSASSLASDHLVENGDRPHSACSAEGSNHLNSP
RSSYLRRLRSTNDMSAGSVSRPLSAHETTGHSIASLMEPNMSHVSRDDVADDFRPPSSFT
GHPRRPSSSSVTQQGNLASPLEYTDGPNSRPDPKIPPGSEIAQSVSPNNAQQGREYQKKS
FGFLKKMSLGKLRRDPARPRTGSTASSSLYNRASGNPSSEANFLDHGKLVSPDGLTPQES
DEHPQGDRSSKSSADETQGSMKLGDSHHTAQKAKKRLNNRRSFLKLEDHFALPTPPPLPL
PGVIAEQDELSKSQSPKVEHSPTVGKSAEDSTSAVTLASSHSPPSAGNRWTALRSIMMYL
RDVHDLSGDFARVHGGMMAGGARPMLSAGVSRATSTKHSQQLPSNMFTDGRSTPSALYPN
NVADFDPESLENGLSNGNSTPNSSAQPTFEPVKVTENALRRFKVIEEIVATEKSYIKGLK
ELHDIYITSASLMVSSSIGKEKEPMVPPAERKVVFNNVEAIIGFHVDVLLPDFQEVMDRL
RQKQAGIAMADSKEPANGNEELMKRRHELESQLTNFAAEELARVFIRHAAFLKLYSTYIT
QFDTALERLREWSVTAPAPSTNVPAWTPSSLAPSNSSAATHHSTLSGGQKKRLKTYMKRC
RAHGSHTQMNLESYLLMPVQRLPRYKLLLENLVSCTPDLSCVSARELESRNQSGALTDKK
LQPLTPNKVAVEALNIVSAVTAEMNERKRDSEGRQRLLYWQQRFGNKFRSPLVQPHRTLI
KEGTMSLMRTVKLTTKDSVTSGGGPSHPSARIRVPVLNTDSQPVAMIVLLCTDLLVLVKE
FGPVLKILNLDDNSPGDGGRASSQSAASLFQALRLAQHSRPQMSLPATIFGADQTMIRFV
DSRAIFYFQCDCQRSAAAWMVAINQQVPLL
Download sequence
Identical sequences PGTT_03701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]