SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_04135 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_04135
Domain Number 1 Region: 826-918
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.16e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.0013
Further Details:      
 
Domain Number 2 Region: 114-334,466-481
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.75e-16
Family BAR domain 0.041
Further Details:      
 
Domain Number 3 Region: 516-598
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-16
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Weak hits

Sequence:  PGTT_04135
Domain Number - Region: 3-93
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00811
Family beta-sandwich domain of Sec23/24 0.029
Further Details:      
 
Domain Number - Region: 780-810
Classification Level Classification E-value
Superfamily ARM repeat 0.0247
Family GUN4-associated domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGTT_04135
Sequence length 978
Comment | PGTG_04135 | Puccinia graminis f. sp. tritici predicted protein (979 aa)
Sequence
MEQQQQQQLINKLSTPSLSTNNQNNNHSKRLQISSLYNQHKHRLHSLLPKPQPTHIQQQP
PPPPQQQEPSTNRLSPEPFDSLINKHFTSSILPGLSSSAFPSSSATDPIIPDAQLEDGPL
LRAQLSGLEHRASLLKKSIKPLIKVFELIHQNLCTSLESDTRLDQALEILDETTPACFRP
LKEIYYKSAKLQNRAIDLERKERLELQILDPLRRMSSNLKEINQKKKSFIHQAKLYDETL
QKFLSIKSEGEAEMKKMEQMKAKVEFARIEYHHWIYEQAVFQEVEVLELLTEYMFSEHAC
RRSPTSSETDTIGIELIHLRQELAIRHIERETQRRAMENHRQAWRNKLDSFLQSSTTADH
HARLLNTSDTPPKAKLMIRTTSAFDHLHSNPSSHRTHELGEKLRGFALTLTGKAFGSEEG
ITSSSPRGRKNLAIPNSLAMAISPSIESDEQFEDHSIKRMRSWSANVQRKKEGFLLSCTK
SLAAGGPVQRHHHHNQQHHPTEQSQGTGGIPNGSDGVRSWKKLWCVLAGGELREYKGDEL
VDPHRSGIDLRYAMVRPRKGKAERKFSFEVVTTKFVRVYQAFSLLEMHEWVAAIEGSIES
ILNSSTSAKTARPKPGGEQARIATLTIPKSKPVISSIAVRRLESDYPAEGVIGKTKAVSS
NTRKKRANTVAHQEGGLQVEWKPIGDSSSLLHHRSAPSDLPHHLPPPARLWSPLPSDQDD
HSPRSRSLTVEEDLESSQPSVPVRPDDQARAKRRMIEEDDDNRRSVTDEGDEEDEEEDEE
EEEGDLGDEEEDEEEEEEEEEEEEEEEEEEEEQPQEDEEEEGTMYERNWTELDNLSHRSS
CAECGKPNPRWASYSLGILICINCCGIHRGMGTHISKVRSLDLDDWNNEQIRQIRVVGNQ
KSKAFWEASLPKDFHLTPSNSISSSGLAKDSLLQIAALVLTVVTVVVTVVVVGTLLTTKL
ANLDHLHAQAQEQDIQIT
Download sequence
Identical sequences PGTT_04135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]