SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_04156 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_04156
Domain Number 1 Region: 369-511
Classification Level Classification E-value
Superfamily PH domain-like 9.7e-21
Family Ran-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGTT_04156
Sequence length 539
Comment | PGTG_04156 | Puccinia graminis f. sp. tritici predicted protein (540 aa)
Sequence
MTDQKSSSTTTTEAHEVKSVREQVEGMGVETEQANIVASDPKTHSTPRTQQNDLDNSPTS
STKGKDLPASWDAYADLQSPFACFAPRTTTWSYAQPSDQSAKEDSTNPPARALAPPPKQV
STAPAFSLTGQQTATNSLCPNKFPSGSDFFLKGKRNTSVADSSPELDEDSASQSKKPKLP
PPVNSSASCPPSSSSSKRNHPLSPTSLRSAALEKFNSNPSLHTTSVQSSTVSTFLDVHPP
SSKASSACADNGENEDSASSTIPSAIPPSEAQKASNNKPLGFSAFATSTGFGDSSAKPTI
DWSDGRVSSPSVFDQQPPSSSKPSHPSQPESQQNPVSEWGGGQTGERKTHLALSAELGQE
DKHEGFLATEVITGEENAELDKSVRCMKFTLGEDQSWRERGTGGLRLLRTKEEPYRYRLI
MRADAVLRVLLNVPIFHGFSYRPTQDKFLTFASTVALEPSAGSGSGTTAPAENEGEPGKT
QFQQYLCRFGKPEARQEIIDSIERCLKDLNQQQKQQSIPDNNQGNHEDPSSVVDASDLV
Download sequence
Identical sequences E3K1M5
XP_003322619.1.73186 PGTT_04156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]