SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_04787 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PGTT_04787
Domain Number - Region: 103-185
Classification Level Classification E-value
Superfamily PH domain-like 0.00369
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_04787
Sequence length 1225
Comment | PGTG_04787 | Puccinia graminis f. sp. tritici conserved hypothetical protein (1226 aa)
Sequence
MVQLIPCSAPDTSRGVPAVPVAGTVYVCALVNSKDVECVLSPPPLGYLRSTCTTSTLPMA
DTDVIRSSIISSLFSPHSKGSAGQTGQTYISHCKTWEDVSTTGERKPRYILLAVGTTARV
FLHKSKRNTNGSFSIGKTWDIIDLRTVELLDESAFRLIIGQRSYTWLAENGNERNKFVDV
LIRSFRQYSQGELPQLIGLPNGDYSTSAYSNPIPSSPVTSAPLSNSNGSRGRSVNPLTSP
NPSSTSLRPSTAPQGSYRSNSPSSTPRGAPSYGTPAPSVATNFTNTSSPAPISTSESSRR
AHAPQLSSGFESPMPSPKLSVTQSRTSGEEETRIGGSPNSKVTRPKISIAGLTLNHRSHS
RTTPPVPDSPAFNRIISSPLRPNQDRYATKEQRPSTAETLDPARQSVGDGEQDLTSSVAV
SKPARPPPAKSAFRSRDSLTAEKSLTPPGTSEKIKIVKQPEETDFDIPDVLSNVEEILEG
FQWRAISSNGPAESVNQIEDQLMTELKALELAEIHAIIENDDRVGTIVTHLDESLAELDK
MEALLSLYRTQLNMVDEDIVHIESQNRGLQVQISNQRVLLEEIEDIMQTIRIPDTALDAL
TQEPLDSQKGIDQLEKAATSLYKAILSVKDMNNITAVAAASDDKVEQYKRNAQQFCKRVY
EFLIVMFKYQAGLILNDKNNIKSRNELKLPSHSSMEKYLERYCGLTLFTKEIDAVRYQQL
CAVEQAISPCELHKTEILEIMSMFRNKVRKPNEEELEATFAAQLSPTTAKMMVPRNPLSK
FEKRDKKEANSSTDVLTAGEALRQFLTQLIPHVQREQNFVIDFLHVHSGLEDGDGLITYA
GYSGLEGYFKRAAVNLQQTAMLNSKLNDILSVMDLIFGFLPGEMKEWVEAMVAADPMQII
SVMMALDLVIGSDILVRSEFLNKILEAQQKRSLNIFELNIKEQLKAIETTRLTVKKRKGV
VSFISTFPDFVLRVERQMEFGETADCPTRKLVNQLYEQISQSMFEALQTMAKSEGDPVAN
SGGGSQEDRDKDRLNYHTLIIENMHHFVTTVSKINAPALKASLEKAKEQYDHNLALYIRL
VLRRPLARFIDYFQGIDELLRTTEPTQIPQHSQYTRASLKRVISTQDKKDIKKSIETLSK
RVDKHFSDVANPSAENSVVMETVWSACEKELIRLIGDWQALLEKCYANPQTESGTSGSND
KGGIPKFEFGIDDVKLAFQKYRPGS
Download sequence
Identical sequences PGTT_04787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]