SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_04844 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_04844
Domain Number 1 Region: 249-420
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.64e-33
Family DBL homology domain (DH-domain) 0.00088
Further Details:      
 
Domain Number 2 Region: 977-1072
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.14e-17
Family PB1 domain 0.0086
Further Details:      
 
Domain Number 3 Region: 418-462,489-533
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000231
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_04844
Sequence length 1073
Comment | PGTG_04844 | Puccinia graminis f. sp. tritici hypothetical protein similar to Scd1 protein (1074 aa)
Sequence
MTTNPPPTPSTSSFNYQNPFSSSTRSSTTTTHTMTTTTTSASSHTSLNQHQSANLSIDMP
IATSSVVNKTANRSASLYQNCLETRALLRRVPGFEAGPWITETKNPNSLLSVTQTLEIFR
LGSPLCFLYNAILNPPLSPPELANLPPLPPGKTWQNLKPLKVLWCPREDLKGCQKSAAHF
IMALKTELGWGTEIDEIQENGLMVNMLYDVNTNATVKVISNVLRLLHLLKALGVLLPPSE
DELVPHSNELNVAMDDRARVVKEILESERKYVQDLEVLQNYQRALLQREILPSDQIRALF
INLDSLVDFQRRFLIGVEANARLPPDEQRFGHLFHSFEDSFSCYEPFCANFASASQLAQD
ENAALTQLVKHTSPNGAYYDELKEGLASITRVTDAVNETTRQRENELAVNDLKERVEDWK
GHELVTFGQLVLEDTFTVVKNESEREYHVYLFERIILCCKEVGVKLDKKASKQSMSLKKN
SQINNSNVNGGKRKNTQQLKGRIFIANVMSATPRPVPPEEQLKKWQAAITKAVDDAVERR
RRQVHHLSSGSRSKMNSPLSQFPNTPQSEMGQPPNSASYQHHPVSHPPRIPEHPYAHSGH
GNGGGSISSRTFEDEEESYQTDAESSVNGRNTPSGSRRTTGHRSMPAERSEASFGPGRAR
AQTDDAASANLAQWRNQMPNSAIPPVPRSGQLTPASSDAYLPNSLRSSTSSKPLRHQPSH
EWGAGTINGSNFYRVDDRSHLPTSGPSGHPLHARHNEPQLLPSNSTGVPMFRSRSASSPN
IHQSPDFSQQWNSGLLNPVPSVPSLPSGSHSSSSTSRPALPLHNQVQIGGHIKQRSSDSS
AAALTDRSSTESQRLSGGVGGGNGVGGRSNLPLSNPMAQTAHGGPPAGGGGLNPRYSSGQ
AGLTGHSAASSLITSRSSGSLVVVQGGSEGVGGSRYGAADQLVGGSHPSKPLGGGGGSSS
TSSTMKSSLTATHNPNNNNNNNNGPTSIRFKLRAGEDTYVIVTLSTITYHELIEKIYKKL
RNCGVYKDSSARLKIRYEDEEGDLILICNDEDVSMAIEWMRSVGISHLLLFVD
Download sequence
Identical sequences PGTT_04844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]