SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_05759 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_05759
Domain Number 1 Region: 1-40,90-106,138-208
Classification Level Classification E-value
Superfamily PH domain-like 0.00000812
Family GRAM domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_05759
Sequence length 230
Comment | PGTG_05759 | Puccinia graminis f. sp. tritici hypothetical protein (230 aa)
Sequence
MALNCSMITPTNDPVPLPGEKIFISVKAVTIYLHPTTPGAGTTSEPTPLSPTSATTSQQD
PSKQSAKGKLSLSGILSAISLNPASDDGSAHGTIYVTNQRILFIAHNASALADLDPPTLQ
PPAPSSQSNPSILLPPIKTLTIPLRNSFDGRFVQPWLSANYHLSTFVPVPNGNLDHLFPS
SANSHSAMDSFTLKAVFNEGHGFEFTEALEEVKNIMFQSDSERPAELEEL
Download sequence
Identical sequences PGTT_05759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]