SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_05926 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_05926
Domain Number 1 Region: 739-1124
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 4.54e-83
Family Gtf glycosyltransferase 0.0005
Further Details:      
 
Weak hits

Sequence:  PGTT_05926
Domain Number - Region: 312-405
Classification Level Classification E-value
Superfamily PH domain-like 0.0627
Family Pleckstrin-homology domain (PH domain) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_05926
Sequence length 1323
Comment | PGTG_05926 | Puccinia graminis f. sp. tritici hypothetical protein similar to sterol 3-beta-glucosyltransferase (1324 aa)
Sequence
MPGGYSSAVLGEAWQWPWFSAAFRFSFRLPSSRLKSRGCYRHKPSPRVDEMPVDLSYLHT
SLPSFPEIVRPGPACEESTPVDWNIKIISTGRYYEGGLMMGSTASLVGMLKAAALSSFQN
LDQTLRSEDSSSIGSTGSASEEEIISEQAAKELVSDVNSPDEDGLAPKDAHLCEGSRVFI
NKFASTLIHQDNPGVASQLSFSPGSPANRFTNRSAGQPVASSSSTHSSDNSLQEDGKLLE
SAQSPVTVQEHLKSVIDHFGPWTETDGNGQPEPESWIKQIPGILTRSVLVQGSILLTNRR
LCYVAYLPPVDTKDLIRSGSITVQCDGIVKKATRMWAELRTESSTKLFRPLHSLHLSEIK
HVLPISSTHPKILQLRLRTGEIVDAKFDTAEATSAWHAGFVSALFTFKTYHSKKIMIMIP
LRRIRKIHRNTFENIAQVMSVDVDCAPCFRDIVDNDIIEGKFTLEDFDRTRIQLSYFLSC
GNFDDLILDAIVRAKLEVSQAESLASHRTPPPLLKITSSHSNEEDSENEEKLSDHVGNFD
SSENALADKFVKAFGLEANTKLPSGFNHSYSGLSTKEKTIDSPYICGMIVYPCLLLRTLP
SPGHVAISQDYLCFWYRGIPVLGSDYKLKIPLKSVGNLKRTSAFGFHRFGLAIETLGAPD
VRLDFTSKSTREEVIEGLKAAVQDSSSRESNRLQDFQPLSSRTPGAVAEPNFTLPRCGQD
TMPVLIGGAKIDKIIKPLRIVCLTIGSRGDVQPYISLAKRLMQDGHTVTIASHPEYRTWV
ESFGILYKDVGGDPGALMAKGLGYFKTWLNNLFMEAWVATKESQAELLIESPSTFSGIHI
AEALRIPYFRAFTMTWTSTTTYPQAFASGIDLGPSYNLLSYSLFDSLIWRAMSGQVNRWR
KETLGIPPTSLEVPFMYNFSSAVTGYWFLDQSHGNFQPPESLLKFIASAKEDKVPLIYIG
FGSVTVPDSTTVTRSIYAAVVQAGVRAIVAKGWSDRVEAKSTEQDVPPPQEVYVLQSVPH
DWLFPQVDAVCHHGGAGTTGISLKFGIPTIIHPFFGDQTFWADRVARLGAGLKIDSLSVN
TLCEAFNKATSDRIIKEKAEQIKEQIQAEDGPSRAVQFIYQHLDFALERTIHRIERTRPK
KTRRSKSAESPKSEMTGATSNSGGEDPRMRVAHRDSMIKRKFTRRGRSTNRTGTVSTTEA
EDVEPNLDTEPSTLAAEPSGLLGKTSTFQPGLIASLNQSNGPAVKRLSKLFSTTDPPPTQ
SDFNPSPIDCCPSGCDPLADSQSVRRKSYPLPFRRRSLFSSLPKNGIAPVNSVSKLLRRT
SPN
Download sequence
Identical sequences PGTT_05926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]