SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_06643 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_06643
Domain Number 1 Region: 448-589
Classification Level Classification E-value
Superfamily PH domain-like 0.000000162
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 2 Region: 83-148
Classification Level Classification E-value
Superfamily RING/U-box 0.00000103
Family RING finger domain, C3HC4 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGTT_06643
Sequence length 1389
Comment | PGTG_06643 | Puccinia graminis f. sp. tritici conserved hypothetical protein (1390 aa)
Sequence
MKSLFYRKPSITSSSGSSFSNTSSHYSQTSFHPTHTTGPSSSSNNNKKNTQSSSSRLPTS
SSSQRPMSPETNRDQPESEINQDHDIITDNCPVCVEDLKMNLIGEKPLVIPKCGHRLHAS
CFQAVYGSLEEARRTGDVLGLCGICRKKKRLGASGGSSFQPKTFDRNLADHSAQKRSRSK
VPSSSTATHKIHSITRKTLPSTPFDIVDDDSDFEEEAHFSESELEREDELLGSWNELDLS
SHQPRLLHPGGLESLRIEHKRQQSGRRRSIVKPNVTVLAENPNLFLNKDSDKSQHLTCMV
TIELPSLYAPNPTQPAYHFSPSSSYPSPLSPTGVPSNLSSDTNQHNNGSSFPGKSSSIAP
MSPPPSAVTQYAMNSPQASSGRSVLLSPSSQHQHDKTRLPSDRNGSLKSPLTRDNSITFI
PPLPVHHDHLPPLPVDGPPSQPLQPVLDDLLDRMQDWKGHSSKDFGLLKKYDQIHVEKEA
NCRQFLVYLFEEALLCVSPVRRDSITQGWTQQDEHHTGSVAGGPPLKLKGRVYIRHMDSV
SVIPNDPLHVYFLRVKMKDEKMDAFTMRFENLNQLEDWHSNIHSLIQKNKQKTDPSPLQA
PLRIPEIDYSGPVCIPSTPLSLPPTPVTCQPGGPSLDRDSLRIAAHSTRSSRSDSLQSGS
DSRNNDGCTGSSLLSGSTKTNLVTSISTLSSVGEEYTEGCPENPEFSNPFQSSHPFTHRD
LLSLHMNPAFRSASLRHDFRPIDLTLVISIPFAEPAGSPSSSPSTLKLRLLKQSLQFVVY
HLHPRSRLSLVAFTVGSGGNTRSQGQLLYTPFLTVGKAASLKRVEFAIEQISRAGRTEGI
LTAQNWKYFGEDIAVAQQASDSIGFGTAAQQANPRFIQDKVQRRLRMLERHEDKVSVVTA
VNLAYDMILPRKQKNPLSGIMLLNDSRDCSTKPEMTLVMTRAEAIHFIRDYHSIKEAIAG
CIGGMLSVGMSNARVSIGIAENKWFKMKKVSGISHVISSDGQHADLELGQMRFGERRDVL
VEVEMKSAREVYRTQSRQFNDGDQALLGLEHNNQVETGTDAFFRNQLGVETNVTMLGDTD
AFTRFYESQFDDMNDDITLFEVNVSYRDPQAGKNVAKLPRPAVLMVTVTPSLVDSTGALT
ANEPSIVKRRVELLTSDSLSRVLLLVSRRMDRQGLRLMNETRRIVTTLMTNLFQIEPTME
QTEFIGRRAFGLMERLMRRGQMKATAENVDVFVMLAGCLQVLQRMIEGLEEIERGLSEVS
RHLEAQYPVQQHQQANNHALRAQEEMRNQVYLRFETGMKNFAAEQSGILRDQKAWLIHSV
DSTVQQQQSRSAFIPSTPTSSQNHQLQLHQSQPSKADDNQLSIIEEIYFRSDYSIWMKNM
MEHWMPERY
Download sequence
Identical sequences PGTT_06643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]