SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_07661 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_07661
Domain Number 1 Region: 6-130
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-36
Family Dcp1 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGTT_07661
Sequence length 770
Comment | PGTG_07661 | Puccinia graminis f. sp. tritici predicted protein (771 aa)
Sequence
MDPRTINFNVLRRHDPQISSILDSTSYAVIYRYFHGAWSKTGFEGTLFIFQRDTHPFYGV
FVLNRQGLDNLCEGLLSGWDVDLDEGLIIWRSAGATGDADDDVIYGIWVYEEKDRTRIAT
TMQELIETASASQKPPSTQQQEQQQQPTQPPPSSSPPPVSLSHPVPRVPIITAGQTISLD
QLFGVGSVCSEPPPQTSALPHPGASVTDPDEEKENLLPSQVMSPDPSDLPKGMQLLDSLF
QKAAIKSQPGSHQSNPAANSEPTHQHPTSIHQLLNQLSGTGSKPQNQINPNHQPSSQPTH
NRRDRRQSSGQENFKHQSATIDQSAAQPAHRTINPNHPTTRTDYPRSINHPHSRRSSGGS
SSHSRNTKIPISLNPTTQSHPHTLPGTDHPVNLVPAPVPIENANAEARHNILSLLGHPAA
TRPDDVYSAGTTLPNPTLVAPPPGNNHTVWPHSSPDSRGASNPRNLYSPQQHSQQGAGPT
SHHAYSSPRSRVASQEPSPHLNSQQQQPLQQGFHQHPLPIPSYGTSADRTPPRGAQISSA
NHSPNGPRPPIDSRHPHQSSGAANNASAGSAGSQSTTHPNGGGGSAWTFDKLPNRALSPL
NPARQSPASLAVHRARAGPHGYSNNTHTNNRKSFQPTRQQQQQQQHLPVENSPPLVNDSS
RPSRSHSYNDHNTTSASNTRQSPSSTTTTAHPPGPTVVNSKLAVESLDRLLVDHNLDPQS
HHPHQQTVDADNPLDKAHFVNSILDLINNNGPFVDTLYARYLARYAEKYL
Download sequence
Identical sequences E3KCY6
PGTT_07661 XP_003326683.1.73186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]