SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_09050 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_09050
Domain Number 1 Region: 163-205
Classification Level Classification E-value
Superfamily BSD domain-like 0.00000000017
Family BSD domain 0.0032
Further Details:      
 
Domain Number 2 Region: 10-126
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000424
Family TFIIH domain 0.013
Further Details:      
 
Weak hits

Sequence:  PGTT_09050
Domain Number - Region: 232-277
Classification Level Classification E-value
Superfamily BSD domain-like 0.000101
Family BSD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_09050
Sequence length 610
Comment | PGTG_09050 | Puccinia graminis f. sp. tritici hypothetical protein similar to transcription factor TFIIH complex subunit Tfb1 (611 aa)
Sequence
MAINDPSSSSIVEAITIYKKKTGKLLLTNSVLKWIPKDGAGSGAEVVSIDFPRLHSLFSS
REGGPKVILKIVAKAISTSPTPTDGSNPTSTGEETYNFAFTSSDPLSDRETFKKHISEII
LQNRGQGQASQAPTQPTDGTEIPKNPPTDDNRIASDKGKAVNPLEDWRLKKRVLQNHPDL
RQLHKEMVIGGQISEGEFWDGREELLYHEARRDAQKTGRSAQMVDPRPETTDSGEIRISI
TPQMIKDIFEQYPVVQKAYNENVPPLNDQTFWTRYFRSKLFNRHRSSARQSGDAVKEDEI
FDKYLGDDDDGIEPKQINTREVFKLLDLAATQEDHAESQANIGEIDVDIAPSIDSGKVPE
RRCGGVIDGGDAGSRNYYGETDLEDLNAPTEPERIILDMREQERYFEGSAVASQSSKRKR
TAEEDAQIIDQMADRLTKGWRFELGKFKIPKDQVNQSTRLMLDNISIRSEQERGFNEDSM
PKDFLAQMVSTYTTTNEFLRQFWTAILPNPMPVSPAISLSTSTAQGTMTKEEEEQKRLLM
MPKPPLTAEQKALKAQRMVGFLSKTNERIQGLIQTAHQIDGFNKSNVILAFQGLLKSVDV
AQKYYKDRTS
Download sequence
Identical sequences PGTT_09050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]