SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_09181 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_09181
Domain Number 1 Region: 32-125
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000209
Family DBL homology domain (DH-domain) 0.0071
Further Details:      
 
Weak hits

Sequence:  PGTT_09181
Domain Number - Region: 820-918
Classification Level Classification E-value
Superfamily PH domain-like 0.00123
Family Ran-binding domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_09181
Sequence length 926
Comment | PGTG_09181 | Puccinia graminis f. sp. tritici predicted protein (927 aa)
Sequence
MNHHPHQQHHPPLPPQQQQQQQQQQPPPHIDFLFDLIRTEKTFANDLFTIINRIASAYSP
TNFPPAHLDRHFRLIESIFRAHNSFLSQSILPIDPPQPNYHLLAFVSLFNQLIRHLLPAY
HRYCHPSGWAGAGGWSRDPHVNSNHLLIQTLLSLDWPGSLSLPTQPPTHTAPAAPSCPPI
FPEAPYPTDDLLLYDSDSAVHASLTVFFALPFARLFYYRKLSQFLLQILQHGRPEHKAVY
DSAQQISLLLDRGRAQWNISPLHFISPSQPPSDPLPNQALPTAQASTAQQSPPRRVSPVP
PASPSQTNSTPVPPNLRSSTETALSGLAESSIGSTTDEVFDQTNPSTPLSSSSATFEAQQ
QATFKTPRDMVQVNRGVFVQQAILNLQTQLDTSRCLDVFSMAPKQCRLLLAPPTLAYSRS
LRYSGDAKFKIRPQSDPNREIETTSGRLILITDLLMFCEYKEQSSPQHPNMWLMYPPLAG
KHLQVTPVGNDSEFGFDVVAMGKAVIRVCVSISLQKQVGSMSPENQTTHDENRSSLKNPK
LSALSSLSINGIPPRLGTQSQPISPSFSHKSERPPSSFSAYLEHQTPQLSPPCPGQYSRS
PSDAGGSLANQMASHSLSPPPNAHQHPTASRDRDSRERGDFPSHRMMNMNGASGQPLRSP
GMYSDSHRSQTGSVPSHSAGEGAHPGQTAALRTLRKAPSAHALGARFDPRTTDLPPMPTA
FGQSLRPSEDRRAVSGMPGMMDPNSIRRSTSTEPYRDRQYRPPSAAISRIHDRPPSGATS
VSRSSKLAGQQISGYRSDDSDSIPPSSPQESSQNVQSILVAEMKTKVFLKQSHSQWKSLG
TAKLHLFVQKGRNSKQLVVATDKGKTLISTIVLTDGIERVGRTGVAVDISDRGVRTGIVY
MLQMKNENSAAGLFEQLLQGSDRRPK
Download sequence
Identical sequences PGTT_09181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]