SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_09287 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_09287
Domain Number 1 Region: 407-488
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000998
Family Vacuolar sorting protein domain 0.013
Further Details:      
 
Domain Number 2 Region: 188-282
Classification Level Classification E-value
Superfamily PH domain-like 0.00000529
Family VPS36 N-terminal domain-like 0.013
Further Details:      
 
Weak hits

Sequence:  PGTT_09287
Domain Number - Region: 95-127
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000294
Family Ran binding protein zinc finger-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_09287
Sequence length 613
Comment | PGTG_09287 | Puccinia graminis f. sp. tritici conserved hypothetical protein (614 aa)
Sequence
MNRLRPIDTTNLTINAQLFFNETIIESQVGIGIYDGLIRQTEYWIGFLKSSPKITLLLGT
RRSSFNQTSQDSPSADDQRKLTSDQNDIINHPAASHWTCHVCGFSNPPELKCGLCGIPRD
LSSTTKSASNSRPPSSLRDLSSLSTSFQHTPSHTRSLSNLRGISTQAEPIETLSSPSHEL
ERIQQVKNKEIPCPSCTFLNHPSMARCEMCDSILGTVQLDRLSLNNSSESTLADSDLQHS
RATTPAPPSSFPADSYIRLSFRKGGDKTFYFSLKKALQSKSWNTNGLKSDFESAKPSARL
EQEGSTQGQHENPSYVSKPIGIDRILKTMDSQQQAHQTELTEGLQDLQALMAKAKEMVQL
SQSINAKLTSLESVPKTGEETETPDQKAGLIRSSLVKLGLPTPAVTPDMISNDQAYAKEL
AKELAGLLTRTMAVGIRPLDEIWCIWNRARGISLVSPADMISACHHLPEYTVPEIRLRTF
KSGLRVLHTPYFSVHEFEHRLLRRLRNTREEGAEEEDGHVDTTSDLIDPLDGTKLMKMST
LEIAQSERLNLNLTNELIESIEQTPSHPSEYHHHHPLSFDKCSLVRDFDPQTGLTFWFEN
QISDYHWEESNSS
Download sequence
Identical sequences PGTT_09287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]