SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_09846 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_09846
Domain Number 1 Region: 149-180,217-344
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.05e-23
Family DBL homology domain (DH-domain) 0.0029
Further Details:      
 
Domain Number 2 Region: 339-410,450-514
Classification Level Classification E-value
Superfamily PH domain-like 5.93e-18
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 3 Region: 702-769
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.76e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_09846
Sequence length 912
Comment | PGTG_09846 | Puccinia graminis f. sp. tritici hypothetical protein similar to FGD3 protein (913 aa)
Sequence
MDDTPSRSNRTPLDRRISLPLLGIDLGRSGPSYGQTLKRMSVAVYGVASNAFEPKDNNAM
KDYDSRPHSFSTDRASGHSAHLAETNSRPTVSISAYGEGSITQSYDSYGSSNSAHSASLH
EKNEFESHMPPSHQSTLTAVQSICSGRMNIFSNFAAILGLSGQFLASLENFGRIHKLFDQ
PVPPQSATLETASDSSQKLQPLHFPKAESSAIKRLNIGETLTEFLPFFKLYTTFTSNFSV
SQSTLHLHSAKRGPSPAFFNLLEDCRRRGVDNGLGLAHMLLGIIQRVPRYELLIKELLKY
SAQTDSDYRHLLSAQTMVGCVARRLEIGMNEQAATKTILTIQRAMEGLAFPLVIPSRKLV
KIGQLKKIGRKGDLQDRVFFLFNDCLIYCGILKNGNAESVEKWLGQLAASFKDPSSAGSL
PTGPVNALTMKHISTSFLLPFTHGDDNSPRLIFCRKMNLHDVTTVGAVGGRKNEYFTGFQ
IISSAKSFVVYANNATEKENWISTLRETKSELLDSRRTLHIKEEFSDSDNTSQSSKLSSI
LEGPASRGYSWLSLASSEEDSNSAPADKLTERTPQKPKNKPSGLSFPALAHYRSPGNGSM
FTNLLSPRARLYSTPSKSSIFNWKPSVNLSIPPLANQMTQILEGIQEAHAGSISEQMSPR
VEPAVLPELKTSNHTQNQLNDQPEAPRKQFGMKYVAENYCAPVWVPDNHVHRCMGKCQAG
FSVLKRRHHCRLCGGVFCSSCSSRLFVIRNQEQGDQLARACEACFQSVFLDVHDGKAKQT
TGDDGFYRPILSNRPHDDQDLVLRRERPHLRHAHRQSLPMDLGSAHFRHSSLANLREDDQ
RRSIVSTVTSVGSDTGCGVTKADELNDFSKNELNSLEEVSKDTPSSIPSPSPAPSQTHAR
QRLTSLLQSRSR
Download sequence
Identical sequences PGTT_09846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]