SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_10834 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_10834
Domain Number 1 Region: 6-142
Classification Level Classification E-value
Superfamily PH domain-like 6.52e-45
Family Necap1 N-terminal domain-like 0.0000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_10834
Sequence length 218
Comment | PGTG_10834 | Puccinia graminis f. sp. tritici adaptin ear-binding coat-associated protein 1 (219 aa)
Sequence
MMNAVADDEFESVLWIARECYVYRLPPRTSSAGYKAAEWGDMEAFLWKGRLRILERGSEN
DPTNSTKCFIRLEDADTGELFANCPYTLDGKSVEPVLDSSRYYVIRVEDATTGQRAFLGM
GFPERSDSFDFNVALQDWTKRQRNTTKREEVDQGPSPHIPSGPKRDFSLKEGQTISISFG
GGHGNRSTSSTTKKSTGSAASDALVPPLLPPPPPPPRK
Download sequence
Identical sequences E3KK50
PGTT_10834 XP_003329094.1.73186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]