SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_12422 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_12422
Domain Number 1 Region: 750-922
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 70-123,297-402
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-19
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 3 Region: 167-285
Classification Level Classification E-value
Superfamily PX domain 0.0000000245
Family PX domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_12422
Sequence length 1254
Comment | PGTG_12422 | Puccinia graminis f. sp. tritici beta-chimaerin (1255 aa)
Sequence
MSTLSMPPNRSASTLSTDSGSIPKLTTTNPANKIEAIESLSLSGNESNELPVLTENPEPQ
ESDSFTIPAYSSSKSEDPSSSSNLIPKTSSSSSRSNLSPTHPSQPPLPPLHNSSSSSTST
SSQQQQPQQYHQQQQPPSTPAANSFPHSAQPTAKRRMLTPTFLPFTQIKVTNSHIRANEK
SKEVISFSININIIIPPESDPERKGAKASWVVEKFYSDVLTLDHLVKSKHSKSQNKALAQ
LPDRALFKDHAPSKVDARKAVLQKYLQSLCTAQLKEKGDVCDFFNSNIVISERASVPNRP
GFMQGYLTKKGRNFGGWQTRFYVLDGPILEYFDTRGGNRLGHIVITGAQIGRQQPRPQEI
NDDSYRHAFLIRMHKREKEGEVDHILCAETDEERDAWVDALTCYVTGRYVSADPGAVASI
PPATSGSSPDSTPSRPAPNSNSYSSFSDNRPGRQTSLDGTSRADGPHPASTSSHHQHSSS
SDLRTESKSSRNAHLRTDSINSSSFNPSASSSHPTENPTPTILEEPLSSNSTTTRKISSE
QPQPPNSEPVRHKSAVSDNRSATLVDARSPPSTSNNNNEAQKPSKPPSQSQQSQSQQQQS
SNAVPLTPRTNIQNRHLQQTIQQGSPQQESGIVGSDGDSITTLERPMTPESQQRPKISGP
MNGAPITGGYRIKPAEEKKAKFRSAFWGFAGRTTERGGGVGGGGGAGGGGGGQSGGTSGG
LGSPALFAPTPRPVFGVSLQEAVSVARVHEGLDLPAIVFRCVEFLEAKGAIEEEGIYRLS
GSSVIIKGYKERFNTEGDFNLLESSKDEYHDVHAVAGLLKQFLRELASPILTRELHGEFL
KVIDLSQRSDKVNELGRLCSELPLSNYTLLRFLSAHLIHVVQNEKINKMSLRNVGIVFSP
TLGMPAPLFALLLKEFDLIFHIDGDNRARFKLPDDLKHLVLISTTRPYLQELELHRLILH
QRRAALIRYSATGADMLMEHNKLSRSKENINEDSDSEVEYDSSSEPDEEMIAAAATRQAK
QHPGRTSQTQDSKNPASGNGGMVARKSHSSGHVKTNSAGRPSTTGSGAGGGGGPATPLVS
IDSRFDLHQPPSSTPNPSLSSSRPSLPRPVSSAIHHHHHHHHHPNHQSPHHHQQQQSAQH
HPHHPHHSYRQSNHPSSLNPNHFLSSSLSSSSHSSASFSDPALNPSSSSVATPSVFPPPP
PPHPHPQRPNHPLSHQRSNSKSLLSNSHSSSSASSSSSLTSASPHAGSRPRTAS
Download sequence
Identical sequences PGTT_12422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]