SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_13314 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_13314
Domain Number 1 Region: 912-1106
Classification Level Classification E-value
Superfamily Sec7 domain 4.58e-74
Family Sec7 domain 0.0000037
Further Details:      
 
Domain Number 2 Region: 1410-1552,1605-1767,1902-2021
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000000054
Family Clathrin adaptor core protein 0.062
Further Details:      
 
Weak hits

Sequence:  PGTT_13314
Domain Number - Region: 271-431,563-703
Classification Level Classification E-value
Superfamily ARM repeat 0.064
Family MIF4G domain-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_13314
Sequence length 2057
Comment | PGTG_13314 | Puccinia graminis f. sp. tritici protein transport protein sec71 (2058 aa)
Sequence
MDLSPIEQQQAISGLKQRTELTSSEDSPSPIRQNQDHHPSFDIQSESAQSSPTIVLTSHQ
TDRSDDQHPVIIHEQIDPRFGPETLPIKFHSPSFKPGSTQDNLANSFDDISLENNLDEPP
KPVHQDSEYKEEEEAHHLKQPPSPQELPTQNPTPSTPISPENNSNNNHKGRSGSSSPALT
VQSSRPTPSRDSTLQETSTIASFSTAQTVASTHSSVSPVLVISSLESIASSKEAKKSKEL
GEATKAALALLKGEQLTSDLGIPSGPNQEAQIILQPLKLACQTASSVLMVTALDCIGKLI
SYSFFKVSEPGPSLENNGDNPTKSSFQVLADVEMGDEVTGIICDCFADAACPDAVQLQII
KALLALVLAPTHPGVRRLQVHQSSLLRAVRTVYNIFLLSKSPTNQAIAQGTLTQIVSHVF
GRVEKGEEPALRGISLRRNESSHRPPSSPKPQDNDSTEPPADVSGSPVTPRPQSSVNTSP
SSVVVHDENGPTPSAPDASQDSPTKNTDQKTNAGVSKEEAQVTLESFEKRNSFDGVSDRD
AVGNPGIMNMQDYYVKDAFLVFRALCKLSMKPLGTESEKDLKSHAMRSKLLSLHLILSIL
NTNLAMFTDPNVIIYSSTTRDQTPFIQAIKQYLCLSLSRNAISSVLSVFELSCEIFWKVV
SGMRTKLKKEIEVLLNEIFLPILEMRNSTVKQKSILLAALGRLFHDPQALVEVYLNYDCD
RTSLGNIYERFMNIVSKLATTQYTTSTTTSQSVELVGSPNAPGNTASSGISGVFGSSTSI
PPSLSTTSMSQGMTESTLYSHQSVEAQLKRQSLECLVAGLQSLVAWAGKGTVPANASAAP
GSSASAMQSSYPNHKGHQASDSSPSLSESGGHGQDPPSGTGAPMAPADSVSNIHSPHAGT
TGTGERERIDDPDRFQTAKNQKTTLIEGIRQFNFKPKRGIKFLITHGFIRSTKPKDVARF
LLTADGLSKAMIGEYLGEGDTENVDTMHAFIDMMDFSNMKFTEAMRTFLQAFRLPGEAQK
IDRFMLKFAERYYQGNPETLANAETAYVLAFSIILLNTDAHSPQVKNRMTRKEFIRNNRG
INQGADLPEEYLSDVYDEILANEIRMKDEVDAAVGVQHVPTGLAGSIATVGRDLQKEAYV
LQSAGMANKTEILFRTLLRGQRHRNSSLSDQFYEASHFEHVKPMFQIVWMPLLAGLSEPL
QNTSAEIEMIKLSLKGFKQSIKIVCLFDLELERNAFLTTLSKFTFLNNLSEMKSKNIETI
KTLLDIALVDGNYLKSSWNLILNCVSQLERFQLISQGVDLDLSNNETASGRRSSTHKPSK
SKQMKPSEEVTGAAGASHITYAADMVFSSSRSLSGTAIVDFVQALSSVSWEEIQASGLSG
NPRTFCLQKLVEISYYNMGRIRLEWFQIWSILGEHFNQVCCHPNANVSFFALDSLRQLAM
RFLEKDELANFKFQKDFLKPFEHTMIHSSNLDSKDMVLQCLNQMISVRVQNLRSGWRTMF
GVFSAASKAKTERVVTQAFELVQRINSEHFSQVVAYGSFADLTVCITDFCKISQFQKVSL
HAIEMLKNLITAMLGCPECPLSRPVGDQAGVDSPPADDIMLKFWFPILFAFYDITMNGED
LEVRKRALDYLFETLKKYGDSFSPEFWDSVCKEVLFPIFAVLRSRSDVSRFSTQEDMSVW
LSTTMIQALRNLIDLYTFYFDTLGRLLDRLLDLLCECICQENDTLARIGTSCLQRLLENN
VTKLDDERWDRVVTTFVNLFRTTTAYQLFDSNLRQPGLESGEGGEPTPSPMADNKRFIVP
TPLPLVAESEDRSQASEAPMTSAERKKVFRQIIVKCVLQLLLVETVNELLCNTEVYHRIP
PASMLRLLAEIDSSYRFAKKFNADKELRMGLWKVGFMKQLPNLLKQESCSAVTLIRVLSK
LYIDQRPDHKAKRSDTVEALVPLALEIMTGYVELDPETQGRNIAAWTPVMVEVLHCFYSL
DKETFQTCIPQLYSLLVDCLGGDLVPDLKIYVQLCLRKVGEHGMGLAVTSQLPRPLSDDP
SSSLAPVPYNPAEQEDQ
Download sequence
Identical sequences E3KS20
PGTT_13314 XP_003331514.1.73186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]