SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_13442 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_13442
Domain Number 1 Region: 483-672
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-43
Family DBL homology domain (DH-domain) 0.0000962
Further Details:      
 
Domain Number 2 Region: 666-751,796-838
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000411
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 3 Region: 342-440
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000544
Family DEP domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_13442
Sequence length 1269
Comment | PGTG_13442 | Puccinia graminis f. sp. tritici Rho1 guanine nucleotide exchange factor 1 (1270 aa)
Sequence
MTSTKPTDKRSTAYSDIFGDKNRPPLQQPHQHQHHYYHQQQQHQHQQHQQHQQHQQQQQH
SYQAYNNHHHSSLQHSLSSPTGSSHQQHPHHQIIYNQPGRAQSLVDRTTPERTYSLNHHH
TQADNLRSQSFGSSARYSLSSSTNSSSKHYTQPHYHHQIDRLSSLHHQTQPLNNHFIPPI
RTSNFTIQEPNLLSFSNLSLHHRPSSSIQPSIPQFDSDSAGLGSIQESTTYQGFDQQAPL
SDLSYSHSIHRKPSIDLDHNSIYAGMSSMPSDQTLSGSQSGQLSPLLIRPRKSCESVRVM
PTQPKQSTANDRSFSFSSGPSSRPRQPTTTLTSRPPIVYPALLSRVAEAFRSRIMLAERT
KDGLTYTECFDGREAVDKIAYIIKTTDRNLALLLGRALDSQKFFHDVTYDHRLRDSHHEL
YQFRGTLTNTFTAEQDNPRNSTHDSLQQTSRPISEAQSELDGLDEEEAQEDEVTEEEEDV
LPFPQEVVDSVNDTEKKRQEAINECIYTERDFVRDLEYLRDASNIIPEARRQDFLSQVFW
NVLEVLSVNSRLCELLSKRQKSAHVVPHIADIYLELVPHFSPFVKYGAHQLYGKYEFERE
KSANPAFAKFVDEAERLPESRKLELNAYLTKPTTRLARYPLLLEVVLKYTPDDHIDKTEI
PKVVKMIRELLAKDLRLREEGRELIYKGQLKKRGGSGSDSAELQVYLFDHALLMVKHKHS
NKTDQLKVYRKPIPLELLTVTGVTNQEDGSTGGRGLNSNKKSLMTRNSGSDKGKGVGTSV
SSNGVVVPIQAQNKAGFSMTINQLGRRGYSIVLWAPTPQSRQKWLDKIYARQAQIREQNT
IFEMVSLNEGFFVGPYKVNCAVPFGVYLAVTSDPTRAPVQVIQVENVTQVDIIEEQGILL
VLADKVVMTFWMDGLDPNDAAGAAKRARKVSSNASFFKVGDCLGRKLVCVVKAGSVSSTI
KTLEPTDNLNHQLNVRTRTKPAFRKIIPANNDALKVYKVSKTGWRCRLDWIIQWEGNPTA
FAFDPSFVEVRHVDTGLLVQVIPGPNLRHLFSESPPSISAPLLAAAAARQQELQQQSKRS
QQQGLIGYPSQSQVALNNPSINSLALNCRPQIIFSADSKVIQLRLKQRQLSVAALNLNAG
QVHHPLIPSNNLTPPLVLQSTTNSSSPAPSSFSNPHPNPTPHPHSNNLNLNQNPSHPPHP
HHLHHHHPAPNLSNNLSPYPPINPPPQLAPAPLAPPQILLPSQPPPPPQPLPNNNLNSNR
HLFHHLYHH
Download sequence
Identical sequences PGTT_13442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]