SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_14043 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_14043
Domain Number 1 Region: 5-54,85-206
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.52e-51
Family G proteins 0.000000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_14043
Sequence length 237
Comment | PGTG_14043 | Puccinia graminis f. sp. tritici GTP-binding protein yptV5 (238 aa)
Sequence
MASRKKVLLKVIILGDSGVGKTSLMNQYVNKRFSTQYKATIGADFLTKEVYIESNDSTTQ
PSSTNPQQAPSSSVVSTNTNNGSDRVVTMQLWDTAGQERFQSLGVAFYRGADCCVLVFDV
NSSKSFETLDSWRDEFLIQASPRDPDNFPFVVLGNKIDVEENKRQVSQKRAMSWCQSKGN
IPYFETSAKESINVEQSFIAACRNALSVGDSMDDGFADYPDPIMLNSEGQQSYGCGC
Download sequence
Identical sequences E3KVZ0
PGTT_14043 PGTT_14047 XP_003332884.1.73186 XP_003332888.1.73186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]