SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_17540 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_17540
Domain Number 1 Region: 608-803
Classification Level Classification E-value
Superfamily Sec7 domain 5.23e-64
Family Sec7 domain 0.0000107
Further Details:      
 
Domain Number 2 Region: 331-445,1292-1355,1404-1462
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000758
Family Clathrin adaptor core protein 0.096
Further Details:      
 
Domain Number 3 Region: 330-438,857-905,1034-1075,1124-1218
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000702
Family Armadillo repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_17540
Sequence length 1579
Comment | PGTG_17540 | Puccinia graminis f. sp. tritici conserved hypothetical protein (1580 aa)
Sequence
MTVAEPQPGHHPWNFQASAFNIIHGEIVAVTSAMRRNSRWAGSSISPFVPLANLQADRAA
GSSAVIGLRNLKTGVDESSNNINNNNTVVRSNETNGPITALALSSIDKFLTYSFINPNSS
SLPIAMSQVSAAGTHCRFEASDSISDEIVLLKILDVLEHALTGPVGYTLTDGAVCQMMET
GLSMCCQMRLSEMLRRSAERTMQVMVSAIFGRLKNLNPSVDDFVPDDDTDEENGLKERLR
MLAPDPRSGSIPAASSLANKERERSQSLSQKASSSLPEESSKAEEPPIDDEKEALLQPPK
EPTPEPTINGATSEGEDLNEDMAEDLEPHGLPSIKELMRVLISLLDPYDPQHTDTMRLTA
LNILITVFEVAGQDVGRFRSLRAMVSDDLCKNLFQLVRSENISILSTSLRCMTNLLDTMR
PYLKIHLELLLSYLMDRLRPHPTLTIHKLTNGHTGTTAEFEEQLDKITWKHLDGIDGIPQ
PTATASSTPNSSRNHTIAARQAMVATGEARQLMLEYLAHFSRVPDFMANLWANFDCNVDC
EDIFERLIRFLARGIYPLNPAYSQSQEGSQVLCLDTLLAFVGHMINRLESSVQPSVDVPA
PVLLARDKEGKRALLEGAAKFNQKPKEGLKFLEAKGIIYDDPTLPRPQSLAFFFKTCPRL
DKKLLGEYISRPENLEVLKAFMTLFDFRGKLISDCLRELLETFRLPGESQQIARITEVFA
AVYVAAGAHDVKTEDAAYVLSYSVIMLNTDQHNPQNRKKMTLEDYKRNLRGVNDGEDFSA
EYLKAIFDSIRKREIVMPEEHSGQLGFEYAWKELQRRSKKAGTFITCNTNIFDKAMFEVS
WKPIVSSLSYAFTHFNDDFMLQRIVAGFQQCATLASRFSLPDVFDETIAALARITDLIHQ
PSPEVNFPTIPADGQTLTISPLSIRFGKNFKAQLAAVVLFTVASTDGNAIRRGWLYIFEI
MQSLFAHSILPNELLLLPDFANVGTIPIRPPKSPAQPPERRADAGLLSTLSSYLLSPYVG
PSDGIGREITNDDVESTLCAIDCLASCHFAEVYNGIFTMDVELRYNLLRILAELADGQVA
KATRARGANLDHLSPPSSPQWARSQAYYDPSALFLLELIVSVATHEPEALSKLWLPAFEC
ISKILANSVMLSQLLVERAIAGLLRLQSIAVEQEALRDQFFLALDVFRSLQQTILNSVAQ
PMIHGVCQIACGNPQVFRTSTQWNMLFSIFTATAGIEEAAKESFQVLNKLAVGELPPGIV
AENFAPFISALNSFASVCGQDGSARFPTQNVSKTDGQVVQRALEAVGMIQNAQEMIPGML
AKAQSDRSRPWASFWMPVLLAYGQQSINGNREVRQQALANLQRSLMAPEILSNGNVDLTI
IFERVLFPVLEELLKPQVFRRDPDGMGETRLRASGLLCKIFLHYLVQLSQQGMPRMTELW
LQILGFLDRFMHSGRRDQMYEAVPENLKNVLLVMHASGFLIPPHENPSAEESHLWNATFE
RIDPVLNTLKTDLFPPPATTTTTTTVSPPSTIDNNHPGPTSVQSDTHANSSPLDPDSLPE
NTLSGPTDSRPPGSENLDN
Download sequence
Identical sequences PGTT_17540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]