SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_18421 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_18421
Domain Number 1 Region: 34-261
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-38
Family DBL homology domain (DH-domain) 0.00021
Further Details:      
 
Domain Number 2 Region: 270-351,425-450
Classification Level Classification E-value
Superfamily PH domain-like 0.000000559
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_18421
Sequence length 990
Comment | PGTG_18421 | Puccinia graminis f. sp. tritici hypothetical protein (991 aa)
Sequence
MILPLSSNLQQPLTPSPSVSKRHSTRPLSASSSSSNWQIPKEFVGLLEPREIVRQSAIHE
IITGEAEYLEDLKIYQNVFIEPLQDQLSPAIFQPIELERFLDQVVSTLGDIRKFSRSFLK
RLRQRQQAQQPFVESIGDIILPAVLEWGPAYITYAADHPLGELEIERQIDQNLLFAEHIS
NIPRFNSRKKDFRHFYSRATFRLARYVLLFTRLLESTPEDHVDREPLRLALELVRRQCSE
CNAAIESQQDIVTLMKLNSMIAPKSDIPLLHLHSSNRKIYGSGKMLRKKDGGSGLGEWSE
VFVVLFDHYFVMLKEKKDDSHPRFRYHIVEQPIRTEFLKISGLTQPPEKRSRRLKTITDG
LRGHNATPSINSTSMPARRSNSEPIHRHSHIPTTEHSNETESTASLQHSRSLYPMTLQPF
GDSPRILTLYVESDSARQNWRERFETAINHRVQSIKTCHVFELWPMALETFSIPSSSSSS
SSLANLPSLAELKVLYEDQIPKELLPNTVHHGISFLQNEGYMIVLAGQVLLAYPLEILVH
SPGGKLLRPPTTRSVTANPNPTYLPKPPRPAVPYHQQQPHQQILSRATSASSQQSARSRQ
SYSGAEMESPIPVGRSSLLLSLGMFEFERQPVNDEEGVLSSSGCDETLVSSTSFQKFSRV
GGVDSCESSVPSSPDSSYKRFREFRPIGNTMDAEKAKGGQTAFKILEPDSGSNEQAGHAF
TLFKENQEFTLPFEAHDVLCHESQNKLLVFHGNRCEVLNLDDLTSATIPRLEENRDEPAC
NILMKRVEEAKLLNILPITAKEYLFCYDKFAYFGSSSGSVIRKKFEKMIEWDGRPSAVTR
YKDYVIGYSDNLIEVWDLRTSTRVQIMHGKDIRCIYNGEGAQQRSLHKPHSGLDNPLPLR
IVKANSINRNSSCESIQEVELLVNQLPQVEKHDAKLGSDNHHTGYAHDRPLSSEKLSPSL
LVQNHFESFHVSIRDSGNAYRVFEMGHVST
Download sequence
Identical sequences PGTT_18421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]