SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_19253 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_19253
Domain Number 1 Region: 283-378
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-17
Family DBL homology domain (DH-domain) 0.0017
Further Details:      
 
Domain Number 2 Region: 389-458,505-539
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000668
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Weak hits

Sequence:  PGTT_19253
Domain Number - Region: 772-819,903-928,969-1063
Classification Level Classification E-value
Superfamily ARM repeat 0.0012
Family GUN4-associated domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_19253
Sequence length 1352
Comment | PGTG_19253 | Puccinia graminis f. sp. tritici predicted protein (1353 aa)
Sequence
MTPVSTLSVEKGGPPLCDEDLIWEQKRREADELNARIEALRQAGMPSSELPSPVLLPIRP
LSKTRTDKPNLNCVPPRDYPVPPLPSFPTKAGLRRQASKKSLHSISSHHSKSPAPPLSQP
NQNRDRTASVSDTSYYSALKEAEGVISSLRKSHDDLLEKVTRLENQLDLKEAENQDLTTR
NNRLETYLVDEQKAKENIQRENERAMNQLRLLSRSQPPHPLNRGDPPSQLHTPAEPSQSL
HGHNHLSPSGSGPLDQKLSQARAELLRREENAQKQYAYRTASLTSELSGQVSTEAERLPE
SRKLELNAYLTKPTTQLARYPLLLEVVLKYTPDDHIDKTEIPKVVKMIRELLAKVNIETG
KSENRFNLAQLDQQLVFRQGEAVDLRLREEGRELIYKGQLKKRGGSGSDSAELQVYLFDH
ALLMVKHKHSNKTDQLKVYWKPIPLELLTVTGVTNQEDGSAGGRGLNSNKKSLMTRNSGS
DKGKGVGTSVSSNGVVVPIQAQNKAGFSMTINLLGRRGYSIVLWAPTPQSRQKWLDKIYA
RQAQIREQNTIFEMVSLNEGFFVGPCKVNCAVPFDNGDRLIFGNDVGVYLAVTSDPTQAP
VQVIQVENVTQVDIIEEQGILLVLADKVVMTFWMDGLDPNDAAGAAKRARKVSWNASFFK
VGDCLGRKLVCVVKAGSVSSTIKTLKPTDNLNHQLNVRTRTKPAFRKIIPANNSMSNPND
PNNNPSVGQQNNPPTVQNALGEIAVVMITMIMLAPSRMLKNHLELMLEVEGKTNFGKFLS
KIFKAFYSILKNASFPSNWLNVNVISHKVILKLLEVVSKILQREFIPTTAHEHDQSKEQM
NLKRAGHVREEPSGSEEEERFDSNLWSDFFVLNHGLLSSKLLIIEEYPPQKRRVIWKLAG
DIRDEGSKIFRAAWESIGDFSITIGSHNPAENNPNQDSQDNPDLNKEDTDQLTEPQHQIN
EVTRCGGYQVQFVPGFIEPLLELCLSHHDELSSNAVIVLYSVIVSEFNLNRDFTVIADEI
IDKLDNLLGSSPNENLSNQMDEMSRASFVGQLRGLFDHSPIIDRQEDPGQQGQQAGIEQA
LKTRIDLFLDSLTQFLDLLLSIQNLPPGDEYFHAAHGNFVEAGLALRLHADLHEWDLNSI
VDAMLGLLLPKQTVFAPKEALYFRILDFLSKGKAWESGIQICKELQEQYEHVLFDNERLS
EVLAHQSSLFLKITTLVNVCSAFSHLVFIPSVQNRQFVYRGYDHIDINWFARWEKYAAFC
DQMHNKHPNAQILQSDTISTYELAYAEGQYLQITRVVAEPDRITVVFKNPEVSSSVVSYY
EHNATKTFSHSKPFSKDNVDPSDTFQGASTCL
Download sequence
Identical sequences PGTT_19253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]