SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_19392 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_19392
Domain Number 1 Region: 4-257
Classification Level Classification E-value
Superfamily LigB-like 3.14e-47
Family LigB-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_19392
Sequence length 267
Comment | PGTG_19392 | Puccinia graminis f. sp. tritici hypothetical protein similar to conserved protein (268 aa)
Sequence
MEKYRPKGIVVFSAHWESPSKEIKVTDYGDDQPLLYDYYGFPPEFYKARWHSNGSSELTQ
RVLACLKEAGMEASRTTRDEPRGRDGLVGPAPGLDHGVFIPFMLMFPEGNEKAFPIPVVQ
VSMDGSLDPERNIQLGQAVAALRPDFRIPPPPPAHSFDHDIESRQGILILSGGVTIHTFE
DFHEWQFESSSEAVKQFEREIINASLKEPTSERFKKMIDLTQLEGFRKAHPREDHFIPIY
IAAGAGSDQGSTKVISDIHVHPFLKNI
Download sequence
Identical sequences PGTT_19392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]