SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_19505 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_19505
Domain Number 1 Region: 93-155
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000777
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGTT_19505
Sequence length 193
Comment | PGTG_19505 | Puccinia graminis f. sp. tritici predicted protein (194 aa)
Sequence
MEVATSHQLASELSNQNLEEVADQNSGVATSHQLASELSNQNLEEVADQNSGVVQWHQSS
EIEPVQEAMERRKEFQSKEVQLKSGVTLNSQENCVICLREYQEIEDPESLLVIFPGCEHV
FHYTCLKDWFNGRRVIKSLFIHGNSCPICRKLAPTKNYSKFLGTALCGSAVLKITTYFET
EIVQMGSGKLVIA
Download sequence
Identical sequences E3LA53
PGTT_19505 XP_003337847.1.73186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]