SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_19652 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_19652
Domain Number 1 Region: 17-140
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-19
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_19652
Sequence length 521
Comment | PGTG_19652 | Puccinia graminis f. sp. tritici predicted protein (522 aa)
Sequence
MPSSSSFTASEKAIIKHVLPSDHNKILAAGLCRIYYAYPDPNKWSYTGLSGALVFGRPSS
GIAGSFWFKLIDISGTRGTIWEHEVYEDGPGRPGHGHFGYHQERTFWHTFQGDDCMIAFV
FVNEDEASAIHKKVINRSKHISKSAAKVKPVEAPVSAPSPVLAPSGKKKGGIDKSMISAP
TDFKRVAHMGYDSNAGFTAENVDPSWAQLLTNLTNMGFSKDEINNSESFIKDYVNQAGGI
DQVLSSHNNTSASPPTRVPPANPVTSKRVKPPAPPAPTRRTGTSNENHNPATPAPMTKSP
SAPSRAPPTSAAPSRPPPTMPVTPAPSAPVSNPPAPPTAPPPPAPVKSAPPPPSAPPPPA
MAPPPPPAPPPPPPPSSHAPPPPPPNAPPPPAPPAPLPPPSNAPPPPPVPSSSISPVSDG
SRANLLSSIQGKGIHVLKKVLRPTSQYFCPLLPGASTHSTGPTNPLSQSTRSAGSDDAHD
GGGASGGGGNLAASLAAALNKRKGTMGEDSEEEAESDDEWD
Download sequence
Identical sequences PGTT_19652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]