SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_00344 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_00344
Domain Number 1 Region: 81-189
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000904
Family Pleckstrin-homology domain (PH domain) 0.051
Further Details:      
 
Weak hits

Sequence:  PGTT_00344
Domain Number - Region: 1-67
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00109
Family DBL homology domain (DH-domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGTT_00344
Sequence length 839
Comment | PGTG_00344 | Puccinia graminis f. sp. tritici predicted protein (840 aa)
Sequence
MRYPMLLNNLLNQINQPNTTPSILRSRAIERVQQALWAMKQVAEGVDEAKSLREVELKTE
LIASRMELHSSYRAAFVCLLGQIKLVGSLHILYHGPSLDPSEAFKIKYHGIFLYQTHLVI
VKVKRASVYEPRHWFPIRYFDLIDISDSSGLMPHSFSLKYRQHTFEFGATCEPEKRCWMN
KLKELKQEIEPTQIDSDHEGPPRSPVEEDQPSDQTAIVPTTPVAAAPPATQSRVSQRLSR
NVNTLLGRTAEVAQAAIDLKLTEIFSDVLLCARLQDSGNESGSRARTLSATGTTTAKRTA
QTVAIARNGNTHNTTNNLADRKMKRMSCMEPNIRPQEIVPPPPLPQLFNGSPDDNTWSGS
TNSNSSLRRARSGPALVSRSSSTLPHSDPDDPTVRLQQPPPQQQQQQQQQQPTPQPPTQT
PTSSQSHQRTRSRNQTHSVLSKIEASQENSPVSASAEQFIPGCRRCPSPDHEEPPAVTTK
PSVVVEPSSTTVASKPICSHSSNPLWLPGLKMVRRLSRVGTRNKKDLEQHQQLGADPSPK
SSLLIPSSCNHPSYQQEQHEQQQQHQQSNKKSGNGRMNRQVSAPNPGSLVDLSATDSYQN
TFKRVFMKRHRSSATPSNPPAPSSPPPHSTNVQQQQHSSSSLKTTEEQGWKIPSVSPAAA
EKENFAADCLPLVAPPPHLHPTNTAPSTSSPLVTHPVTTTSPSTPAHLTPSSSTTKSSSS
LSACSNRTSATATTTMTTITARARTTTGRSTASSVDSSASLASSSNLSNKSSAAGFHAGF
GSMFRSIMRLTPLTDPSSSSGPRSGSPGSGPSSTPSPSGSPSGAHLTTTTTTTTTATTH
Download sequence
Identical sequences PGTT_00344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]