SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_00485 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_00485
Domain Number 1 Region: 526-655
Classification Level Classification E-value
Superfamily PH domain-like 3.87e-16
Family Ran-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_00485
Sequence length 658
Comment | PGTG_00485 | Puccinia graminis f. sp. tritici hypothetical protein (659 aa)
Sequence
MVKRQAEKQLTDRNCDDVEPDDTPSTGVLKTASLQAISKRQIRALPKKTGASVSKPASQF
GAVPPFPANGKPASTLFGQAPQSFNPTPSFNLFGGSSSFGTTKPTAFGTAPSAMSNSPNS
TDPSNKQELITYYSSLRGLNLSVTKAFEELIKKDAFMDLGSAFDHVKQKYNEHRREIEAQ
LERSQPSQTDKAITSVTAEAPVKSPFNFASNEAPKVSSTGPTLSAGGEARTTPSLFSFSP
SNAQKSSEGSSSVENPTVSAPEVHPSSDEADNLSLPSANGSAAPGAKAGSRPGAFTMAAP
MRPSPLRYESQTSPADSPAPESAEEPAKSAFSLAPITQASKPESSLSSTANTADQQPNPK
EANTDDSSTVPLPLSESKSKTTSLFGVTGPSAAGTSAPSPFFTSKPLSYTSLSAQNSTAK
PSSIGFSFGIGAAGNGSAFGGFGSPKSAPGQATPPKNAFNPVGFSFGSSPPTSSVFSTPK
PSENTSTEPGSTNIISTSTGNEKPDAGSENLAGEEGSDDLGTSSTEAKAVDSKKGEEDEE
TLFETTGRVYALLDKKQEDGKVQKGWVGWAICNVRLNRHKETQRCRILARSQVNQGILIN
FFVRPDLKPEDRGNSLEVLGFNPEGSHLQAYRVRPASDQVVKDFHKAITEVVESLAKS
Download sequence
Identical sequences E3JRH9
XP_003307535.1.73186 PGTT_00485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]