SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_01455 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_01455
Domain Number 1 Region: 833-981,1155-1170
Classification Level Classification E-value
Superfamily Sec7 domain 2.35e-38
Family Sec7 domain 0.00048
Further Details:      
 
Domain Number 2 Region: 1313-1360,1395-1464
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000257
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_01455
Sequence length 1703
Comment | PGTG_01455 | Puccinia graminis f. sp. tritici hypothetical protein similar to guanine nucleotide exchange factor (1704 aa)
Sequence
MRKRSGFFRRKLSTSLSQADLNCQDSPTANTHQPLELTFTPTHSESRTPRHPLTSDSSHH
HHASNLTPPVPIIPLSYHSSSITPSNPPPPMPLKSRLSSTASTRHSQQHAHSIDSQDSKQ
PGSSTPTHSTPSLNSHQEAFRQSMSASQLTRHGSPSESLFSPSPSSRSHSPAHSSFKHQQ
QQQQQQQPPLPSPSSQPKSSWLHSTSRALVSYSERPDPLSPRGAQSRSPSSNNFPPTSLS
KTRTVPASFDSGGPGKNRPVLTSTTFVGSNSSTVDGGQIGLPGGSLTQHASASLSSSFLP
DSPSQSHRLSNLSSTTGLSEEEKLRLSLERWNIDQDGILRGGLSSISPMTPKASASDLND
PNNSHVQDGAISERAYHKSLILSPPSIHQYNLTKNPLPPDSSTLSATPCLPSLVNPNRTA
IQARYPAEPFDKSHSSLARIRALNLDTSTSPIPSSSLALVSPLALSSKQSPSSDSSTTQV
NPGSISSPNLSTSGLSSSQQGFVSRASSMKESRDVSVSPVTSTRGNSLRRRGYTEDDHAL
APKLLGSQFPAPSRHPSLRPQTASQPVSRTTNLETAPSNTVDQQLGLAPENEDSETDDPL
SLLSPSIRLVSSSHTTSTSEQDHANPPVAGNQNAPSLSTSSSSSSSPSKQPISSTTPSHP
RSSIFNRGDPSIFTKPSGHASPPIRAHHAQLSKTAQPKRGNAGLGIKPIVESDRPVTQHN
PQLQRRDIDKAQPIKSGASNEDSRTPRNHQSSPNLRALRPSTPPESSFFSVIVSGPQQTD
EQSTAIPPDGRDNLTVHPQSHTLQNPSSSSNSGNSDKSDSLHSGSRHSLHVPGMTPEANA
SRLAELFWQEDESIIKRRKLTEWLGCPETPENQLQVLTRRAFMDKFDFKDLRIDLAFRKL
CTKMFLKGETQQVDRILAEFSRRYWEQNQSNIYVNADMVHAMSYSILLLNTDLHVVDTTS
RMSRSQFVRNTMETVFAQLSHLETPEANRSKGLLMEPSRSSSSNNETFGSNYKAGSSAAS
MAMRNRRTSFVDMSRVLPASAMSSQTATRPSMERWRDALRTGSQSIVKTPRRSQSITSWP
SEDDLQTTSAGTPLPGSSSTDHERTASIDTGASCSPAANRTEDLSSTVHLNSLENGSPAS
KPDRPNKALFEKEVEALLKEIYMAVKSHPIAQNLVESQSHEPGPYGSLQRIASRRSHYTH
GVADSIGPHKRASLRGFGGFAAMLSAGPDTPGGRPNSPTPSASTSVSSLPSGMMGYSSNA
GSSLNLTNLTTPSIGFVSNLSQSIIREQHEEESLETSQIDDEQTRDSELALLGAPWAKEG
ILQRKQYWESKGKRHKDRGWAQVFVVIQTGVLKMFQFGGGGGASVGGGYGGGQAESEVGH
TETIGSDGKSGVGGGNWLPNAQLLGSITLSHALTSVLVSGYSKERSHVFVLTLSNGASYF
FQAGTEELVYEWVSTCNYWAARLSKEPLTGGVSNMEYGWNQLLEAELPSVVEKKEELREC
QGDQEEMMSIVSGHSGHSHKGRRLRDRLFTGLPLGTPHSPTSITPSNRASDVEHWSNSAT
SIDTHGTPSQPEFKTGSNLHLDRVPPQPPVPDKLTICDWNPPVPPMALSSLPEHAQLENL
RRHNAHMQVELERHNLLRRPMVNMYWNRPIYLQKAMANWEKKSQYLMAEIIKYTTYLNAL
ESTIKLKLSLATKPALVPLSSSS
Download sequence
Identical sequences E3JSD7
XP_003319281.1.73186 PGTT_01455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]