SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_01699 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_01699
Domain Number 1 Region: 231-351
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000148
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Weak hits

Sequence:  PGTT_01699
Domain Number - Region: 22-202
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0288
Family BAR domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_01699
Sequence length 484
Comment | PGTG_01699 | Puccinia graminis f. sp. tritici hypothetical protein similar to cytoplasm protein (485 aa)
Sequence
MVNIGGHLPVPLREGNQFLPEGGWQSILYDTREQTRAMADYHTTFAHTITHSVLHTLNHV
KNDIKIFITDLENEPRALASEVGQHRVDSTRLLSQLAQGIAHSKSNPHAMTAKDDPVLIH
RQVEAQLKAQLNFENSLTHMIIEYQKKAFELEKRVNTDIQTAVKDFEAARLQAQEATNKH
WQTIHNGITQLDPEIEWNEYAQRSGHLIPESITMRDAAKIAFPGQNDETTKPIKAGFLER
KKRYTKNYKEGFYVLTPSGYLHEHKSSDPAKHGEPELSIFLPNCSISAPAPEGSKTFKWH
VEGSKSTSGGNQMGSLRKMKKTLHIGRKDIAFSFKARTYAEMTQWWELLQHPAKSSFTQA
TVRSSMPPGAAVSAVSDIGLDKTSPQSEAPPTVTRRVAESSSDGESGGSSEEEDAAHSHD
ELSTAPTTPSGLHHDHPHMSPDAVSEGLPVYKGGDHTEAAMANLKEKPEIHPVQDVPQLT
VSTS
Download sequence
Identical sequences PGTT_01699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]