SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_02170 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_02170
Domain Number 1 Region: 1092-1204
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000117
Family Phosphotyrosine-binding domain (PTB) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_02170
Sequence length 1580
Comment | PGTG_02170 | Puccinia graminis f. sp. tritici hypothetical protein (1581 aa)
Sequence
MEAISPQSLKLYPYSTLHLLLNPFINVSNNSSKPSHTKFNLLAELELRISELESTGALVS
ASQHKSKTRVRERTPATPNHYETQGLGFESLSGESTEASEDESNPVDEDVLRKVEELDAA
MKRWQEGNSEIWRQARGEPPGVSRPSTPSHSPNGMMPITPLGHHPPSATTPLTSDPKPVP
VNQQCPATDQSVNRRVRNTQHRANDIEFATEIGQSLLGEVRRLQHYSKATGMGSNLGFST
ENDQLRTSLAHAQRTISTLRGALQRKKEDAMRAKKSSVISLGDPAKASDMLIRDDDDDDD
DDDDDDDNPHDAQFPRKLLLSSSTRGTPREGHVVGPFAELAPQIGTKIPPTTHDDDNGEG
GVAEDDDDETRDLRPLKEALGGHSRNSQVYGSDDDTTRSLGFICRSSLQIPDDIRAELAR
RRLDSDADTKAIVSGVEVGTMTDEVAPKTVEVIKEVRVEVPVEVEKIVQVDRVVEVEKLV
EVPVDRIVEVEKIVDRVVEVPVDRIVEVPVDRIVEVPVDRIVEVPVDRVVEVSVDRVVEV
PVDRIVEVPVDRIVEVPVDRIVEVPVDRIVEVEKIIHVPAPIASETLQSLPSQSPTTPQA
VATRDDHARHLQSDRNDDPKPPVEKIVEVEKIVEVEKIVEVEKIVEVEKIVEVEKIVEVE
KIVEVEKIVEVEKLVEVEKIVEVEKIVEVEKDCGSREIGRSGEMIPAEKIVQTEKLFPKQ
ANLEDPSSSLRRSLDRDVTPSQFLASTPLDHSLKSVMLEIGVQTESLDGLVQPATNSIYN
LSPRDSMATFGGGSTSRTTDCSRDTKASSMKKKPPPLSSSSGLRRTHAHQDSVTSPTGSD
EFSRNRCSLNSLRTETTSNSEQLTPACSPKRNHSMELDNPMNQTSHVSELANSSTSQGPS
KPPPPLDQRRQINPIPPNSSGLPPQRPYSPPPKELVEKAQIPRTIQLAVPSVPPIRRSSY
SSMPPPSSKPRTGKASPATHISKKKASTLTRANKLFNSADNHSESPEVSQFGIALMAPVV
HSSNEHIRRKMQLGNLSMMGGSTEQLSQRSRRQSFNSDRTDHTSDPGDDLAPRSASISAP
TTTDPNAIHAITQTMIGEFLFKYTTKTLTRGFSEKRHRRFFWVHPYTKTLYWSTSDPGAH
GANQSTAKSVLIESVRTIDDKNVAPSGLASHSLVIQTPNREMKITAPSKERHELWFSAIN
YLLTRPDPSATTSPAFNQQNISPNPSARGPAQSTFSSRNTMLSRFRTQDPSILNTPPAVH
QAIYDMSSSKSLNDSPAIASTGSSERLTPKASKGPSGLPVPMKRGAAPSRGSTKQMADSP
RFLQSSPAEPIVFDNSFSQSAFGLHQDLDRRSVSFNGIHRGDGEMADDTDVSMSYDSRCD
DTLDDGFEGVENVRACCDGKHDVGSLSRRLAHSSNHEHSHVIHSRPASRGPSGKQREADR
TSYVSSRALRPLDSPSLRASNLEALRSRYGGASSPGPQAQAQAQAQQTPPHLRRVQGRSS
VIGQAALSNSLQSSPAGTVSSRFHRESAFFQDLKSFNAASVEQLQTPPPRSSSRFPKQQM
DNLAASIHSSRRGSVGSDLG
Download sequence
Identical sequences PGTT_02170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]