SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_03199 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_03199
Domain Number 1 Region: 773-993,1033-1232
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 2.83e-86
Family Gtf glycosyltransferase 0.00088
Further Details:      
 
Domain Number 2 Region: 97-194
Classification Level Classification E-value
Superfamily PH domain-like 9.97e-20
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_03199
Sequence length 1514
Comment | PGTG_03199 | Puccinia graminis f. sp. tritici hypothetical protein similar to sterol 3-beta-glucosyltransferase (1515 aa)
Sequence
MSNTLCLRTQSPKSRSSHNRRHQHDHNLAAKRSQILSRKLQQVFQLPSDEKLLAEYPSWL
FRSLLLKGYVYLTTAHVCFYAFLKSNEREVDEEGESIKAGILTRRHSRKLNQRQTVKSWF
ILKNTILSWYPSSHEIYFPTGQIDLHFCTKVEPAPANSKHPNQFKLFVSGKVYTFFSDTQ
QSKDEWVKSLQQTIFACQHNGQNVKIAIPLSSIASIEKCDSIQFAQTVCIKIKENAPALP
FAPNRIRSPQVVPEEIGDSSLVDYFFGFLQDSQTPYELLRAALERVEASSSSALPTTISD
QPPPESSLTTSADAPSRSRTLSPIRDSTRFRVPSTPLPRLGDDYFATSALGLVSRSGSQT
PISSDAPSNLASEERKTSFKFTDKISKIASSGNKFVGSPIRPAFNNTVKVRTPTSANPIG
LGPRPIDSPTCSSTQDPKSLPMSSASPSTSESPPQEQLPSQSFGSPQLDKLNRSSTGKNP
LAQSHTYPPKDRRSHYSTYSPRERSDSSTPVSALNSPRLNPHESPSADPNKSWTLLPGWL
KNVPTTLNPIKPAKDVINSAKGLMTSAQDPSSSTSTVNKKELPSRSPSAEKLSDEEGTSR
LDRGAQLTQRDQIKFQTEFNFLTTGVVSNSTNPEGPIRLLLKTKCNLLRSGSSMYGQVYL
ASPVPAQSLKQKTARKSCVCFKGQKWISSAPVKMILPVEALTAVRAEALRLYLTTQKTDV
LADQGEHKHKADDGLQADNHQEEEEEEDGASLPIMFESSSSSFLTFKPKSKLHITCLTIG
SRGDVQPYIALCQKLQLDGHRCRIASHGEYRKWVEGYGIEYVEIGGDPAELMKICVDNGM
FTLGFLKEAFSKFRGWLDELLVSSFEACRGTDLLIESPSTMAGIHIAEALQIPYFRAFTM
PWTRTKEYPHAFAVPDRKMGSGYNYMTVLESDVRSGEQVEEEKLGLKSTTYEKLEVHKVP
FLYNFSPSIVPAPLDWYEWIHVTGYWFIDEDDPNKTSQQALAKSDALSDSLIDNLTSSPP
VIKPSPQKTSWNPPQDLTAFLDRAHTQNKKVVYIGFGSIVVPDPEAMTKVIIESVKSAGV
YAIVSKGWSERLSGSGGKKAKRAGTSEEEGAEAEDQSMIYHINSIPHDWLFPRIDAVCHH
GGSGTTGASLRAGIPTIIKPFFGDQFFWAERVESLGIGAGLRKLTVKNLSNALTLATSDA
TQISRARIVGELIRAENGAAKAVECIYRDLDYARSLIKRRPTQLPETAPATANAPAQNES
QTNSLNEHLSTAPGPSSSTNLEQAETSAAEGGKKETSEHAGGDSEVRTIRRPDQEEAEDS
GQEANESSLLLMSAHSSVSTDHRPPQQDLPPSQHSSDDFFDCPHPPPSSEMISSVRPPSP
PPPPSSSHSSLKRKDPKNQKEDEGNRPQAVDQSNQHTLMAQKSDTTIVPKPAPLSHPVQH
EDAPPVGQDPQKVGQINPSDQPKGKQTSSALADDEHHLSSDLSDSSSSSWDILSQQSKSD
PASVADLSTSFDQF
Download sequence
Identical sequences PGTT_03199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]