SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_03864 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_03864
Domain Number 1 Region: 672-723,795-851
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000402
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_03864
Sequence length 944
Comment | PGTG_03864 | Puccinia graminis f. sp. tritici predicted protein (945 aa)
Sequence
MPILVHSRASTFPFRRRRASSPYGRAASSMESLNNPTLPDEQATLTDMSSHIKPSSVSHS
NLSQAYHQNQPDQSSSRILRPFRHPSTHFEKFQAKISSVRLRSSTLNPTSSRSASHTGST
TDISPSTQSLNPSRKMPVEIRLPWESTHSEELSRRPLNNSQRPPPDSHSRIGPSPSLVSI
DHNSDSSSHLTLTSEPSSNKLSKSSPWSSNSPPELELGFSFNSPSLLSGLPYCEDSLPSD
SASPGLPNNPAVPFGISTIDGRSSASEPTTVATFSDSSNSREMACSMPRSQQAIHLSEPI
DRSPIVNPYVNGASSSLTSRVRPTPSPRNNFPIRLNGPTIESPPLPLSPTHHPSSPSTPM
RALPMLNSYPVTSNQVRQPTDSSGSSLGDHGSAEYEVEAEDQAGSDDTDGVSDEGSPQVD
RHPQEQPPMLTPKLSTQAADQFNSTQEPTAHTCRHEWINFDSNTPPVSQHKPTPPHQRSP
QLSASSSNHTSYFNTPSDTKSSTAQSLGDRARLLLLTTPSSSLAPPPRPARPMLASHRSH
SASRLDNISVSQHPTESPSVTISPAPKPKSPSPCDPKPITQLPPVIVADVDNQTLTNKAL
TAVRRQPTSQSAFLPPPSSFSYRHQSMYELRPAASLPSYEASLQSSGSTRHVVLPREEEG
REKLPSYSCAIHLEGWMPRKMEFKSPGVQAKDRAWKRQYVIVHGTMIRVYRSDPHTHMLS
GSEDPYSSNFVHGKSISPLASKCGITSKANPSAAPPLHFHQGQYDSAPVTSLKEAALVKA
TQLPTHHNCLHRVYSLQNAESGLAADYVKKKYIVRVRAEGEQFLLQAKDDRGVIDLIEAL
QAATNVSLDLDIRPLPKFITLPRRRRRRRIVPPSAATGTSGRPHRVAGRELGAAVVEGMV
AEAEASHRRRLQQQRESAVWADDSGDRMADMLAEEQEAYMQGRS
Download sequence
Identical sequences E3K0T3
PGTT_03864 XP_003322327.1.73186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]