SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_04295 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_04295
Domain Number 1 Region: 1363-1486
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000493
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_04295
Sequence length 1689
Comment | PGTG_04295 | Puccinia graminis f. sp. tritici predicted protein (1690 aa)
Sequence
MTPRELSSKPSSSKLNSARTLPRVDQNDSERDPSSRTASGENHLHSSAAAPRQSEAFKRL
GQASLVSSSIFKSAPSTPNQPSRSTTNNQPSTVAQTGSQATPASRFPFTPQRAPGTQSQM
AAALRGLGIASQLSSAADTHRAPPTTRPLPNPTPSTPLQAIHKPGTKRKSDENLPIPPRP
PPNLPPSAPPLQMLNQMNQKARPPPRQSNAFNVLTRNALVTSSPFKSSGSDPSISKSTSS
SSDNLDRATSSPPPTSFVPSSESDEVSSHGSDLDPASSPPNFRADLPVRPTSPRPGGSTN
GVLKMQRLGGPRSFTPPHTSQSSGYVSEPETCDPNRRVPSALSCPSRRRERRKTVTWGGE
DVLEFEWEEEWRRTSANSSSDSQISDSKLEDTSDISTESDVSETPQALVGHPSPEHQSHS
SEFWQGPSTTTELNGLASHHSNEHNQPTYQEDDHDAIDQSNGSVVIHDGSQEPLPPAVSG
IDTSYTANSQSSEIDPVDQMVDELLTSPDLAGLVNAQAGHTRPTASLVHGQDRNCPPENF
GPPEETLAEADKAVIQKNNDLPQTNHVQPRSRFPYVKAENSDQLSERPETVILPTEAPST
SNPTPLEQIPPSQAASFQPISLSCLGLEDSLFGEASVISSILESSTLDVEGLDAMSLAPS
QPMLSSTPRASYSDQLPSPNPPSPQACHPISTAQIEVEEAPSAHTSPRRPLPRPPPASSN
VHTAHPALQALSATTQSAYNLPEVPHSSPFPSSNQLSGSATAAWVRPASEAVTSESDTGG
ESGPGSPNGNRPRITRKRIHDRIRDRDRASKTGEESEDISLSILSRAPTSHSASIHKLGL
NGEEEKLELSQDITMDSDEPTRSTVTIGPLKEIQARPPMRAQQVKLSSNDDLLGIQEAQL
EPGNLSTISSGLDKLARGFQALEDGTKSSDSSLSLIKPEGLNVTESPALPSKTVMIKGAG
RRRRSASTGGADLDETGTGTGAKAAVKLIYLFEHQIRHQSTPIKRYSMAVDKENSKITSA
LLHNTIQPAMSNTDLQEPLNRVLNRANNARSYRVSEPDEIVVASDHTMTAGVAGDVAANR
NWRKVRKVSDINQHAAQLKAFWAQNGNTNKIGRVFIKMSKLVFRGVPLSQPPAHFQVVID
NGLHTVRTPFYKLEPEVTIGVEFELVRAKKLEFSLAFCVPLNEPLNAHLKPPLPPKPLSP
PRPVSQVVPQSVPHSPKRLFGFFGASSKRSSKHQQQILLEKQQQIQIMEREKAVLARQLA
ARSTPHPLVGLLDRNHVLATALVNFEQYAHECLGKWKHAVVPCMSALEDPVKAEMQMRRT
FTGPIGQVSLEFLSLPPIPKLPNATIPNSGSECLKGLKIAEWWQEVWHEGVLSQLGADCL
TWRRRTFKATGGSLFAYNDIMKKLSAEIRLTEVVSLQDCGSENVDENEQPKHSTINDQGE
ILPPFTFRLVFKDGSEILFHADNQTEFKRWKNVLKQLLGKIQPLPAWAELLRLQIAARQA
SSAEDEKSEEERAGGQKQSAKPVGHRQPGRRPRSPKSRAMASKPPSSSSQASSISTLTSA
ASSSYPTNLSDITSNTYSSMRPASALMSSQAPSQASSQAPSHRLKPSNIGSDASSSRRPP
STLLTSSPRPTLSAMSSVGSTAMSSAGSAASSVHSRPTFASGSSANNLPPSSRPIQSQMK
RSKGNVKLV
Download sequence
Identical sequences PGTT_04295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]