SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_05939 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_05939
Domain Number 1 Region: 713-1134
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 4.08e-98
Family Gtf glycosyltransferase 0.00041
Further Details:      
 
Domain Number 2 Region: 309-419
Classification Level Classification E-value
Superfamily PH domain-like 0.000000585
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_05939
Sequence length 1291
Comment | PGTG_05939 | Puccinia graminis f. sp. tritici hypothetical protein similar to UDP-glucose:sterol glucosyltransferase (1292 aa)
Sequence
MDPPTTPIPGPSSPPFSTGPSLHSTPVRPSLSFAHHSLGSTASFVGILKAAALSELENSD
FYGSSRSPDKKASIAQQKNSHKNLKAKLELDSEDDDEDAEEEEDDDDDDEDAEEEGTEDE
DDDGESAQDDLVDTPPELSPKFNSFRGPSQLGYPSPKALQGLACELINQQKRVADLAVRK
GINSSTFTPEPSSHRSSLNQSTPRCSSPLQISRKDYSGSAPITVSDSNNTTQSSCADSES
HVSSEERLHRLEEQFGVWPGKDAQGQPETESWIAQVPGVLYRSVLVNGLIVLTDRRLCYL
AYLPTFDKGQIIRSGSVTVKADSRFNKRRRRWVELRTDSLTEYRLSTELFRPLSSYHFSE
IQRILPISSGQSRTLSLRLLDGRLIVVDFDTSEAADLWHQDFVRALFSFKTDYSNQIKMM
LPLSRINSVHRETFESIAKMMVFEVDCAPSFCRSAKSDVIEQHSDHPSTPERPRIELSYY
LKHDPFDDTVIDAITHAKHNASQHLFPDSTPAPLLELLDHSPAEDEAEAENITSGKADSN
NSCNSKLANRFMKAFGLDASEKLTVYSCALLRTLPTLGHMVLSNDYFCFWRRGTVITQDY
KLRIPIKDIGQVKEATAFGFTRFGIAIELAGAPDIRLDFSSKSTREEVMQALEDHAQAAK
AEEKRINRRLSNMPIPKPLGQNTEQFKLASPALKKQRPVVIDKQQIERPVKAMKIICLAI
GSRGDVQPYISLAKRLMQDGHTVTIASHPEYRPWVESFGILYRDVGGDPAALMKLSVEHP
FFSTGFFKEGLGRFRTWLDDLFMESWLACRDSGAELLIESPSTFAGIHIAEALRIPYFRA
FTMTWTSTSTYPQAFASNIDLGPSYNLLSYSLFDNLIWRAMSGQVNRWRKQTLKIPSTSL
EKMQPYKVPFLYNFSSVVVPKPLDWRDHVDVTGYWFLDQSHGEYTPPADLVAFIDAARQD
QVPLIYIGFGSVTVSDPTAVTKAIYAAVVQAGVRAIVAKGWSERGNTKNSLDDAPIDPPA
QVYDLHSVPHDWLFPQVDAVCHHGGAGTTGISLRYGVPTLIHPFFGDQPFWADRVTKLGA
GMRVDSLTTQSLSDAFIKATGDRIMKEKASQVGEKIRAEDGPTRAVNFIYQYLDFALERT
EHRIARTSRKKRWVSSVSGCAASQPAASVDGSHPELESPALRKADLPPCSASFENEDPNH
LSDSSPDSPSLLPANAQGKLADPPQSPDDGTLTRKKSIAGGPIRSYSHLIKIPNAISPVK
SWSKIKKIFLMWYRPAHQGHFWLWVQLLAAV
Download sequence
Identical sequences PGTT_05939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]