SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_07225 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_07225
Domain Number 1 Region: 528-792
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-85
Family Protein kinases, catalytic subunit 0.0000000225
Further Details:      
 
Domain Number 2 Region: 21-204
Classification Level Classification E-value
Superfamily PH domain-like 5.32e-17
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_07225
Sequence length 809
Comment | PGTG_07225 | Puccinia graminis f. sp. tritici serine/threonine-protein kinase shk2 (810 aa)
Sequence
MSFSIPFGSLIPSRPPPAPPNQQQQQQQNQQQHQQKENHLSSSSSSTSSTSPYQHHHQSF
NQRSSLHQSITSGHAPSILSKSTSSMIGSAPFPSNPSSPSLSGSNLALQPNPTTIVRRGF
AKLKEDGLRSWIWSQRWLILREQTLTFHKNETTSTAAALIFLKEITNVTRTDLRPYCLEV
ETKDKTYNLALKNDEELYGWMDDIYSRSPLMGVSNPTNFVHQVHVGFDAVSGAFTGLPEQ
WTRLLTSSAITKEDYAKNPQAVLDVLEFYTDIQKRENEEYPIGSGGHQHQQSIDTSKLDH
YHHQHQHSESTHPSPNIQNNNSQNSSNTGFSSYPSRTAPSPVIQHSESSNHSAGLGDPGQ
SSSSTNFPRINNPQPSQSRPNLVPQRVAPVAPSATPGSGGLKPLSLSSSASPRPPVQPPR
ESAKQLAPAKTQGPKPLTLGQPRPANGATTTTTTTNNNNNNTGTAKPSGNAVPAKPAASA
PPSQETNQPAQAPIKALQTVKKQEAKQNERRISSLTEAQIMAKLRTVVSPQDPNQIYAKI
KKVGQGASGSVYVAKTLATGAKVAIKQMDLKVQPRKELIVNEILVMKESQHPNIVNFLDS
FIVRDDELWVVMEFMEGGALTDVIDNNTMEEDQIASICFESCKGLQHLHNQSIIHRDIKS
DNVLLDAQGHVKITDFGFCAKLTDQKSKRATMVGTPYWMAPEVVKQKEYGAKVDIWSLGI
MAIEMIENEPPYLDEEPLKALYLIATNGTPTLKKPERLSKELKNFLAVCLCVDVKSRATA
DELIQHEFLKKSCTLAGLAPLLKFKTSSR
Download sequence
Identical sequences E3K9X8
XP_003325392.1.73186 PGTT_07225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]