SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_09262 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_09262
Domain Number 1 Region: 841-1246
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.09e-109
Family Oxysterol-binding protein 0.00062
Further Details:      
 
Domain Number 2 Region: 71-334
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.07e-18
Family Ankyrin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 379-481
Classification Level Classification E-value
Superfamily PH domain-like 5.32e-17
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 
Weak hits

Sequence:  PGTT_09262
Domain Number - Region: 647-698
Classification Level Classification E-value
Superfamily Staphylocoagulase 0.0235
Family Staphylocoagulase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_09262
Sequence length 1272
Comment | PGTG_09262 | Puccinia graminis f. sp. tritici oxysterol-binding protein 1 (1273 aa)
Sequence
MRSVNSTPSPHRRRAQSVAVLSNNSSPSSTTQPPTTTNSNDSSNQQQQSSPSSPSHPKQS
PVDESLQSFKLLQALRTSDTESILNLLSTQYYPKDQPQPSSHPESQLTPLHLAVRCATCN
KFSLIIIHSNEVAELVLANSPANVVTSQDSSGQTPLHIACSLSRADLVTLLLAHPQVDDS
IRDHHSRTCLEVCKSAQVAKLIQAARDQISASFLALLSAYIASSQTSVVSSSSVNATQSS
GNISDVIPSSTAINNHESAADQLYKFMNLPRCKSIDFSLKEDQTGTTLLHEAAKRKDIYL
INLAILRGADVLARDKRNKMPIDVAIDEKVKAILRQAASTEGRALKASAHAKAWSPENYQ
STSSFPNTTHVPATASNGSLTQPTLKGYLSKWTNMARGYSTRWIVLEKGFLSYYRDEHDE
GKTLRGSIAMSVAIVVGPDVTKDKLRFEVSSKLGNSYPRFYLKGAHPLEVMRWVDALKQA
IEVANQTVSPSNDKNLSRKASVPLANADKRSFVSRHLRHSRHIPSPSSASTRRNMSVTDT
SGRPRGNTTDPDSPPRSVFAHSTSEDDDASRPDRSQLPFENEIDLLVQSLKAHIEMTDQL
VNSLAIPSGAPTPPLNTSQGSTSATGVIEPANNSPTASQRQTEVKHALKRSVEDLSVMFD
DYITKINKRERYHIRRYEEELQAKRLWEENMQALLASQAEMERQLQSVARDSSRRKKQLK
TLRAGINESNAAINTTNAEADETAEVAEKSEDGKPAGTTATSASRPVSVAAARLEQLSGS
SSEDEDDDDEFFEAIETGAIAVEPMSVTKTSPSERVLHEFDMEELKEGYETKRTTLPITA
DDRPSVSLWGILKNSIGKDLTKISFPVSFNEPVSMLQRMAEDMQFSECLDAAAEQPDSLV
RMAYVAGFAMSNYSSTVGRLAKPFNPLLGETYEYIDPDKEFRYLSEQVSHHPPTSACYAE
SPRWSYFGETDAKNKFTGKSFEIKPTGVAHAVLNIPKTFEGTQDYPPFKRNPDRVEEHYS
WKKVTTVVSNFLMGSPTIDHYGDMEITNHRTQERCVLTFKPRGWRGKDANEVKGSVYDKN
GELVWELAGKWTTQLIGRRAGSASGDLGPDESVTASRGREYLQLWKNDGQPDNMPFNLTT
FAMTLNAMNGRLKLFLPPTDCRLRPDQHAFEKGQWEKANELKIALEEFQRATKKKRELGE
LPPHTPRWFVKVDDPDSGELTWDAIRSPENGVSILYWEERKRVGASRKQNLEVEWTDVSH
IFGEFESVETDC
Download sequence
Identical sequences PGTT_09262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]