SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_11784 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_11784
Domain Number 1 Region: 532-693
Classification Level Classification E-value
Superfamily Sec7 domain 1.05e-48
Family Sec7 domain 0.00016
Further Details:      
 
Domain Number 2 Region: 948-970,1002-1060
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000939
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_11784
Sequence length 1971
Comment | PGTG_11784 | Puccinia graminis f. sp. tritici predicted protein (1972 aa)
Sequence
MEQQALLLPSPNIIHSTRPRPTPKPKQQQHTPIPTINTTPPYQKPSRHSEPQAQLSLPTK
PINRSRSSEELPHNRIRLLPNSSPSSPISSSFQLPLLPPKPKPTQPQQPTQQQQPTQTTT
NISQHEQPTLPPLSIHPTSQELSSPTQQRPTSNLSPNLSRNPSFSSPDVLPQLDLSSSIT
PSRTALISTTTTTTTTTEPISRRSSRRFSQSNIDPILHQQQQQQQPRKLHSRASTPLFTI
GNPDEKDDSRPHSAVSHLSTPSLFKRIKAGLTPKSSFASSSSPPLSTAIELFPDLTPSSS
SNSINPNLQLNNDGIQRRSSTDLQETVGYFDLSSERSQSDSMGPHQRQTMEELRGTTAQK
TSTTAMTTTTAGTKKKSGGQPSANNHPISRSFSQARIGSSPANRGASELRINRSLGPASS
FSPREYNREAFIDPRLRSSPAPSSLPSSSMPLTMTSVANTQRQQQQQQQQQQQQQQQQTA
ATPKVKRPTRNSVSNPIQPIIELTKKNMKKEKEPGRPTTTSATAISSTVGKSKPLERNPT
DESEEAYLSRLGALFEKSKIPSILASSNDPFHLSALTKYMSSFEFSHDPIDLSLRKLLMV
VDLPSETQQIDRVIESFSKRYTHCNPKLFTSPDQVYILAFSIIMLHTDAFNKSNKAKMSR
ADYVKNTRMDGIPNELLEYIYDNITYTPFVYVDPDRDISGQKITSQHQQTTEQHTSTSFF
NLGGHSNNITPILQSSSILPGTKESKSKLDPYHLIAKGSTHELRPDLGAVIPSRNPFSFT
GSVSWFDFKRLRDSFHPSKSVIIQVVNLSPTKIASIFKLIEAEELPSDHPADGSPSTSSP
LLRRNPTHDAAPTLSPLDSKSPALVASPIPSSSSNPVINPTFLNLRAIKVGLVHLKIDTF
TPFSTSPPPPLTSSASSSLSHSLGNHHNNGPASNSANSLNEISMSKNVINKKWKLFCVLL
TARQLILIKDVGLAGELQESIKLARFRNEANPEDQLVVRITGLKPDLVLSLDGGIALLDS
EYQRRPCTFRLVLTKDLSLLMGVDDHEDMNSWITHINYAAAYKTHRLPFWVTNRAESSPR
ASFTSRPTTATTMTKSNTHRIYQRAGLDGTPETINGMGRGANEDSAESLLSFSSSLRKTG
AHHHQYSQGGEKNETKARRSVDDHPILSRTTSFSNHHHHHSMIAAAARPFDLGPSLIGES
PRSSSTNSNRLSFLSSHNLPSHWDLVRAQIISLEGQIMAAKTELNEDLRLARNLAVLTPF
QFSTRSKLQLAIMPVANRVRNSRCQLSKLVCYREVLVRDLALGVALSNNGSGSTKINNTS
EKTGILMRKTGGSKEDGQADDPGQLIISSSPASCKPIPAQEFVIQTSDERRLSLTITSGD
RRSHPLSTLDTEDHQSASSKRGSDLPESSADPAPPPPGPSSNSTSTSLPVITDNRPIEIT
SRRPPESPPPAAAAADTATVTADPSDDLTSSTATIVLPSAVKNLTRNLLARSIVPSISAS
RHSSSSASVASKSPVLVDLAQNTNLSQPPLLDDHHHHQSQEEENEADNQKDDDETDDDSE
GGEGLASLCKVGRHIEADPNNPHDLQQQQPSTTTRIRNHEFMGRSTSKLTSQTDSFSSSS
PSSSWSRSTTTNTMMGRNRSGTSGSTKSIRDPQLQHYLHSSFIASHPHLLPAADNVSNPL
LPSRSPNHNPSHHINSPVPSSSLGSIGMNISSSVPIPLVSWSSSSSRTPLKASASLSGPS
SSSSAAAASTSTSTSTSAWRPPSSSSRPSSILTHSIFDPPTSPVSVSAPSGPPLDTPTSN
PPPHPSTHTSSSSASASASSASTTTTTTTIQRTRKRSAHPHLLTQLVPGSSSAVDRNAAR
ARMLLKARALEQSSGGLLHQKNSKKSSNGLADGGLVRSLEGAPPSTSTATATATPIGLNP
TTSSSSSSSSNQQQQLKDGGTGGSGRTTGSIKSTASFLGVSKKLHKAWGLP
Download sequence
Identical sequences PGTT_11784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]