SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_13407 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_13407
Domain Number 1 Region: 377-544,593-754
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.03e-103
Family Mammalian PLC 0.00000573
Further Details:      
 
Domain Number 2 Region: 212-376
Classification Level Classification E-value
Superfamily EF-hand 6.84e-30
Family EF-hand modules in multidomain proteins 0.0082
Further Details:      
 
Domain Number 3 Region: 770-910
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-19
Family PLC-like (P variant) 0.0067
Further Details:      
 
Domain Number 4 Region: 87-196
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000578
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_13407
Sequence length 917
Comment | PGTG_13407 | Puccinia graminis f. sp. tritici 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-3 (918 aa)
Sequence
MPLALVSGSLVVQSNFTSALVGGGCVGSLMVMLMDCEDIPVQPSKHEGRSPVSELSPKGF
PQQKLSLKTQQQGEHSEEEGREEGNYVPAQLKAGTLMLKVSAKKTIKTNVSLEYERGQIV
WETKKGGSLNIESVREIRFGQDASYYRTQFKLSPELEGRWLTIIYLSKKSTYKMLHLIAC
DPDTFALWKETLLRILAFRRELLGGLNHMRKRQDYWLKQNWSQGDSTEDAKLDFQEIVNL
CRKLNISVPQSDIQAHFDIADSQKRGYLDFPAFQHFVKLMKRRPDLESLFQQFTSGRAVM
SVDEFTRFMQNVQHSELTPSTIHAIYTKFLDDDNDDDREREARELNPTKQMTIEGFASFL
QSADNAALHEKHTAVHQDMSLPLHDYFISTSHNTYLVGNQLKGESTVEGYIRALQHGCRS
VELDCWDGDAGEPVIYHGRTLTRKLQLSEALKAISKHAFVASPYPLILSLEVHCQPAQQE
RLAELLKTCLGEALVDRPLENLSSESLPSPKDLMYRILVKAKKPIVGGDGPRSTEIYSNF
DSSATSTTSGSSTSSDSDLKRRISNASTVLGERFKRIASAMSIPSPPVERSLPTTTDQSP
TLTGQSGSAALIPGPSVGSLAPPPSKIPTAPLTNSLSSLIVYTVGVKARGFNKLTTYEKE
HILSLSERTVNKFLKAGPLRMLDLIQHNRSHLTRAYPAATRVFSSNFLPHRFWAVGLQLV
ACNWQTHDLAMELNSAFFDQNGRSGYLLKPLALRVKGKEKDAATKMHKYQLDITIISIQQ
LPKLTIEDDNAGIDPCVEVQLISPVPNSSCTSPPQSTKRRTKVVKGNGFNPVYHEEFKIQ
FQTPGEMVDLCFLRLLVIDAGQGSGNGAKEEDGLVGKVCVCLGGLQPGYRHLPLHDDSGQ
QLLFASIFINSSLSKLP
Download sequence
Identical sequences PGTT_13407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]