SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_13865 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_13865
Domain Number 1 Region: 32-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.42e-115
Family Motor proteins 0.00000000254
Further Details:      
 
Domain Number 2 Region: 462-566
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.87e-22
Family FHA domain 0.00014
Further Details:      
 
Domain Number 3 Region: 1299-1377,1520-1618
Classification Level Classification E-value
Superfamily PH domain-like 7.95e-18
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGTT_13865
Sequence length 1622
Comment | PGTG_13865 | Puccinia graminis f. sp. tritici kinesin-II subunit (1623 aa)
Sequence
MEAGTHTFLDPPPTENEAGAGDQKSKSKSSATDKETKSFAFDHSYWSACPKDEPGYASQQ
TLYEDLGVDLLNNSFEGYNSCIFAYGQTGSGKSYSMMGYGQDRGIIPLTCSALFDRIQEK
KVTDPAVCYTVEVSFMEIYNERVRDLLNPKNKGNLRVREHPSLGPYVEDLSKLAVQSYSD
VETLMDEGNKARTVAATNMNETSSRSHSVFTLLLTQRRKDATTGMEGEKVSRISLVDLAG
SERANSTGATGVRLKEGAQINKSLTTLGKVISALATAGSSGPGKKKKADDHVPYRDSVLT
WLLKDSLGGNSKTAMIAAISPADYEETLSTLRYADQAKKIKNKAVVNEDPNAKLIRELKE
ELDTLRSRMSGGHSEDTYDVTLPPEKQIVKYQTKSGEIKTVTKAALQEQLEQSEKLMSEV
AQTWEEKLKNTEVVQKEREQALEELGITIEKNNVGVYTPKRMPHLVNLNEDPLMSECLIY
QIKPGTTTVGNTETTEPCDIRLSGRNILAQHCHFESDKETGAVELFSHPNAPTMVNGQRL
SPGKPRKLRSGYRVILGDYHIFRFNHPEEVRKHREKVNTTSEPGAELRSPLTNDHNGSAS
PLHRPDTPTSSSVIDPQDYHYARREAVISKLNGTEVNLDEMDEAEFEKLFDDVVRLRMQR
KVGTSVSGRESRMSYISEEEDILSASHRPPSGSTFVTDDTSVAGSIFNDLELTIPEEGNQ
LKRSPSDLASNGAIETEHLRLEKEQVENQMKELKEEMEQKLEVQKQMFQKKVKKLRTKSM
QFNHNDLDIAFELEDWTPQERHLARISIKRWKKLNRVKIAEKLLRKAVILKEANVISREL
NKMVTYQFIIVDRSPLELTTSALESIKGLSEFDDVSDPELSDRSNRPCIGIKVLDKRHRS
VYLWSLDKLETRVSQMRNLFNFIDKPEFSQHFNWEDPFYDPSPPLYSFIAHAFIPLGPIY
RNTPIKTTLSLYSPYTLASIGTCRIQIRTIGIAPPARTGILLNSPNGTIQPTVNESLCPL
VDDAKITLEIIIDEVVGLTSRDFSSVHCQFRASSITGVLKDGTEDHVWSSKAFDLPCDQK
EMVLKQTISVVMSPQTKSHLAHGCAPIEFFGQLMPSYLDRLERQDEKKAEEKKLLDDNGG
RSELLSPQSDSACPTLNQQSTASIIRMRQPETEFVVEQMHDVTSAIKMLELTALGDYQST
TIISQNALDPGVFYLRQGLQRKLAIRLTHNSGRQFGWQRMEKVEMGNVRLLDGQGRIHSS
KVDRWVSIKASKKPVVHFEADGTSWMDYVGNWDAGGHESHYLDRVTQSEQRVLVELRWEV
EAKNCVEPIKFRTDIGMVVKGRDQRVGEGILSLLRIERRLKQMNYLFSIKLKPMMISKVD
ELWRLSTVNQIVHGEERLKGWKTRGLGLLTEWINFRDSILLKTEVDGIKAIVTSLTLKSI
NELDERLRNPEPGAADLFKIGKSLELWQKRFGPKGNMNFLEEPQLIVLDQQPIESSSTPK
QTFESPKNRRLKAEVRLIPRHENAIRKGKLNVLRDPTRDDWVNRWFVLKRPYLYIYEKND
EVEELGVINLLNVHIDSNPEMELMLNRKNIFAIYSSTNSYFLECLNPKDLAEWCLAIKPL
IE
Download sequence
Identical sequences E3KT69
XP_003331913.1.73186 PGTT_13865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]