SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_14625 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_14625
Domain Number 1 Region: 30-203
Classification Level Classification E-value
Superfamily PH domain-like 1.99e-33
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 
Domain Number 2 Region: 428-555
Classification Level Classification E-value
Superfamily PH domain-like 7.35e-20
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGTT_14625
Sequence length 576
Comment | PGTG_14625 | Puccinia graminis f. sp. tritici hypothetical protein (577 aa)
Sequence
MTHTNSRPTTSTKKPLSNLIIPTTTLTTTTTTPTNQHQQQQQHQQQIDIQAINQTLSSPI
NSSFPLFATNPQPNSALQLDIESEDDEEEDPYQPSTSHYRQFGDIENEEILHSGYLLKKG
ERRKTWKRRWFVLRKTCLVYYKNEKEYCLLRIIPLTEIHTCAEVEVKQYDNTFGIVTPAR
TYYVRARSRTERNQWTSKVTAASLLLKSLENPQRPQPSAQKPSSNPATPSAITIINQPCY
PTGLPPTPICSPNQTTTNPISIVQHGEPSSSSSAVSWASDHFNLCQPSKVEALDNTATIT
KASIRRGLSLSAQPFETAPYESPASYHHPPMPFRANLSSAGSSAGNHQQSSETSFATSQP
SQVPQHSIPALMSSSEEDNEVDDTLPPTRRATCGPNTHDHLIHNPTDNLTIPVPILPERK
VSLPEAGKTIIQGYLMKQGKRKNWRKRYFMLTSQKLIYSRTHMDVGGRHTRQIPIGRLLD
AIEHESAPESPGILSGSVVGGTTSTHSGGGGGPSGPSTHHEDHYFKIITSQRNYLLNAPT
EDDEIRWISAIRCLLDSHRANLPRSFDGILDHPINP
Download sequence
Identical sequences E3KUD5
XP_003332329.1.73186 PGTT_14625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]