SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_16760 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_16760
Domain Number 1 Region: 494-721
Classification Level Classification E-value
Superfamily Cullin repeat-like 1.31e-42
Family Exocyst complex component 0.00068
Further Details:      
 
Domain Number 2 Region: 352-450
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000256
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_16760
Sequence length 776
Comment | PGTG_16760 | Puccinia graminis f. sp. tritici exocyst complex component EXO84 (777 aa)
Sequence
MLQIGFTMNIPVTPAPRRPGKAGVSLRTQRPTTYYDGEKDASSVPPPTEGGRKPPRPAAG
ADGLPGGPRPSAKAGHPNRLPPSDKKARGMPIDQSGGARSTEKSKIGAALLNKRQSVSYG
HAQPKSTPQPMPPMPAIPGRFGGNRNDDRIGGGVRKQVSSGAPIINIDSETLAQGDFDAE
KFMMIHLATLGGGAADPETLKAFKDSLRATHLTTNQSLQENAYKNYGAFVAISKEIATLE
NEMLELKAVLEEFKTLPNDLDMGLGAMAESNLCECNFLSKQISDRSRVSGVSDLGMAAGE
SKRKAARNSIADVNALYRNQLESLWENVEGSQKFLPIQPGRHILSETKSFVELNPITYQP
KQAVHLFLLDDSLLIAIQKQTRSTTGKAKLMAEKCFNLAQISIVGLDDTPDLSNALQIQR
NQEKVILRTDRAQEKRELLDSFRRVSEEMARKKRKQSLNADHSYRASRLLSSQGLESGSS
QFHAGKLLGLGKDDRTHKLYSRIGDLLDEVSVGIACRRYEEAIEHVERARSMVTEWATGE
AGVGDIANPLEGRIEARAQELADRLLAELAETSVKKAHLVRTITLLGRLAGPSAPVERAK
ETFLTMRSELVRRQIGQIKFEGDLALWVSQTSFVLFTLVKNTCEWYMTAFKDNRLASGFV
KWAVDQLDLFGEIFRRQVYEGDEDQWTIQESISVTRAHAGMLKEVGLDFGFLLSNVLSNQ
TQTIRTRHRLTTTGKPRALSADPAAPRRLPSTLVSTDSRSSTMGTNRYGLQFKHDA
Download sequence
Identical sequences PGTT_16760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]