SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.001G150500.2|PACid:26821933 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.001G150500.2|PACid:26821933
Domain Number 1 Region: 31-212
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.45e-72
Family Inorganic pyrophosphatase 0.00000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.001G150500.2|PACid:26821933
Sequence length 215
Sequence
MSEEDKNEAKVVETPRKPPRLNERILSSMSRRSVAAHPWHDLEIGPGAPAIFNCVVEIPK
GSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDCLVIMQEPVLPGCF
LRARALGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKDLPPHRLTEIRRFFEDYKKNEN
KEVAVDKFLPATAAVEAVQYSMDLYAEYIMQTLRR
Download sequence
Identical sequences A0A0B0N5R5 A0A0D2LST5
XP_012480585.1.20347 XP_017615110.1.75545 XP_017622331.1.75545 Gorai.001G150500.2|PACid:26821933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]