SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.001G150500.4|PACid:26821935 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.001G150500.4|PACid:26821935
Domain Number 1 Region: 31-174
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 8.63e-63
Family Inorganic pyrophosphatase 0.00000652
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.001G150500.4|PACid:26821935
Sequence length 182
Sequence
MSEEDKNEAKVVETPRKPPRLNERILSSMSRRSVAAHPWHDLEIGPGAPAIFNCVVEIPK
GSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDCLVIMQEPVLPGCF
LRARALGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKDLPPHRLTEIRRFFEDCILFNI
KL
Download sequence
Identical sequences A0A0D2QIT0
Gorai.001G150500.4|PACid:26821935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]