SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.003G085800.3|PACid:26797622 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.003G085800.3|PACid:26797622
Domain Number 1 Region: 80-117
Classification Level Classification E-value
Superfamily IpsF-like 0.0000000000196
Family IpsF-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.003G085800.3|PACid:26797622
Sequence length 154
Sequence
MATRFYSCSLIPARPTSGSVLNKYSLLPNPRISITRRHTTLVSSSSSSSSFTLRASVSSA
ATSTAVDGTISSTKPSKSLPFRVGHGFDLHRLEPGYPLIIGGIDIPHDRGCEAHSDGIFL
IPYTFGWFKFINIFPIFISNLYFYLKFPQFCIWD
Download sequence
Identical sequences A0A0D2ML61
Gorai.003G085800.3|PACid:26797622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]