SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.003G085800.4|PACid:26797621 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.003G085800.4|PACid:26797621
Domain Number 1 Region: 80-160
Classification Level Classification E-value
Superfamily IpsF-like 2.88e-32
Family IpsF-like 0.0000974
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.003G085800.4|PACid:26797621
Sequence length 160
Sequence
MATRFYSCSLIPARPTSGSVLNKYSLLPNPRISITRRHTTLVSSSSSSSSFTLRASVSSA
ATSTAVDGTISSTKPSKSLPFRVGHGFDLHRLEPGYPLIIGGIDIPHDRGCEAHSDGDVL
LHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEA
Download sequence
Identical sequences A0A0D2QQC3
Gorai.003G085800.4|PACid:26797621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]