SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.003G085800.5|PACid:26797620 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.003G085800.5|PACid:26797620
Domain Number 1 Region: 80-162
Classification Level Classification E-value
Superfamily IpsF-like 5.49e-33
Family IpsF-like 0.0000974
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.003G085800.5|PACid:26797620
Sequence length 166
Sequence
MATRFYSCSLIPARPTSGSVLNKYSLLPNPRISITRRHTTLVSSSSSSSSFTLRASVSSA
ATSTAVDGTISSTKPSKSLPFRVGHGFDLHRLEPGYPLIIGGIDIPHDRGCEAHSDGDVL
LHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVSISLM
Download sequence
Identical sequences A0A0D2RJ83
Gorai.003G085800.5|PACid:26797620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]