SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.004G137800.1|PACid:26774308 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G137800.1|PACid:26774308
Domain Number 1 Region: 78-234
Classification Level Classification E-value
Superfamily IpsF-like 5.49e-57
Family IpsF-like 0.00000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G137800.1|PACid:26774308
Sequence length 235
Sequence
MATHYYSCCSIPAKPTSQTSSNNSIWLPNHLVSIPRHRNNLVPYLSSAFSLGDSISAAAT
SVGVDGPTTSTNPSRSLPFRVGHGFDLHRLEPGYPLIIGGIDIPHDRGCEAHSDGDVLLH
CVVDAILGALGLPDIGQIFPDSDSKWKGAASSVFIKEAVRLMHEAGYEIGNLDATLILQR
PKLGPHKEAIKSNLSQLLGADPAVVSLKAKTRKKVDSLGENRSIAAHTVVLLMRK
Download sequence
Identical sequences A0A0D2MXZ5
Gorai.004G137800.1|PACid:26774308 XP_012474904.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]