SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.004G137800.2|PACid:26774309 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G137800.2|PACid:26774309
Domain Number 1 Region: 78-164
Classification Level Classification E-value
Superfamily IpsF-like 9.29e-33
Family IpsF-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G137800.2|PACid:26774309
Sequence length 200
Sequence
MATHYYSCCSIPAKPTSQTSSNNSIWLPNHLVSIPRHRNNLVPYLSSAFSLGDSISAAAT
SVGVDGPTTSTNPSRSLPFRVGHGFDLHRLEPGYPLIIGGIDIPHDRGCEAHSDGDVLLH
CVVDAILGALGLPDIGQIFPDSDSKWKGAASSVFIKEAEKPVSYTTSKVMLYADINLCYM
LSSRSSVVVFCMYSLQENPC
Download sequence
Identical sequences A0A0D2PBK1
Gorai.004G137800.2|PACid:26774309 XP_012474906.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]