SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.004G149200.1|PACid:26771939 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G149200.1|PACid:26771939
Domain Number 1 Region: 21-202
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.83e-69
Family Inorganic pyrophosphatase 0.0000052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G149200.1|PACid:26771939
Sequence length 206
Sequence
MSESTEAPRPRLNERILSAMSKRSVAAHPWHDLEIGSEAPTVFNCVVEISKGSKVKYELD
KKTGMIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDCLVIMQEPVLPGCFLRARALGLM
PMIDQGEKDDKIIAVCADDPEYKHFTDIKDLPPHRLTEIRRFFEDYKKNENKEVAVNDIL
PVNTAIEAIQYSMDLYNEYIIQTLKQ
Download sequence
Identical sequences A0A0D2PC93 A0A1U8JZI4
XP_012475051.1.20347 XP_016693714.1.88148 Gorai.004G149200.1|PACid:26771939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]