SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.005G142200.1|PACid:26801332 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.005G142200.1|PACid:26801332
Domain Number 1 Region: 10-175
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 1.5e-55
Family Pollen allergen PHL P 1 N-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 154-246
Classification Level Classification E-value
Superfamily PHL pollen allergen 5.23e-37
Family PHL pollen allergen 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.005G142200.1|PACid:26801332
Sequence length 250
Sequence
MKMAFAKVFLLGFLAMVFGVQGYGGGWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGT
NTAALSTALFNNGLSCGSCYEIKCMDDGKWCLPGSIVVTATNFCPPNNALPNNAGGWCNP
PLQHFDLSQPVFQHIAQYRAGIVPVAYRRLPCRRKGGIRFTINGHSYFNLVLITNVGGAG
DVHAVAIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFKVTTSDGRTVVSNNVAPAGWSF
GQTFTGRQFR
Download sequence
Identical sequences A0A0D2RF00
XP_012478707.1.20347 Gorai.005G142200.1|PACid:26801332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]