SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.006G175500.1|PACid:26831823 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.006G175500.1|PACid:26831823
Domain Number 1 Region: 32-198
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.11e-66
Family Inorganic pyrophosphatase 0.00000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.006G175500.1|PACid:26831823
Sequence length 264
Sequence
MAPPIETPTKSSGSHHASHPPLNERILSSMSRRSVAAHPWHDLEIGPGAPMVFNCVIEIP
KGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLIIMQEPVIPGC
FLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNE
NKEVAVNDFLPASTAYEESLRGLHRGELEAVVLGSPCPVYIQIYINMNMNMLLLYKKFIV
SLCGQKHPALTGFATKKMCFSFYR
Download sequence
Identical sequences A0A0D2SZK0
Gorai.006G175500.1|PACid:26831823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]